ࡱ> (~ijkl=>?@ZTu - . /   bcd;~~  #+ !"$-%&'()*,.3/012456=789:;<?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Root Entryr ڋ@ContentsEmbedding 1 2Z0`}.(ƓContents  Q !"#$%&'()*+,-./0123456789:;<=>?ABCDEFGHIJKLMNOPRSTUVWXZ[\]^_`abdefgijklmnopqrstuvwx{|}~junknownunknownCTlxFrameState CTlxFrameInfo%:dd!dCTrellix.MapViewCtrl.2"dGTrellix.MapViewCtrl.2#dATrellix.MapListViewCtrl.2$%dTrellix.PageLayoutsViewCtrl.2TdyTrellix.LexiaViewCtrl.2 1C:\Program Files\Trellix Web\WebDesigns\Gears.tldCHydraCntrItem  V + www#X HV + R KQArial%HOMER KQArialV + R KQData Object 12  2Z0`}.((Contents KData Object 13 2Z0`}.((Contents Data Object 15 2Z0`}.((ContentsData Object 16 2Z0`}.((ContentsArial Site map forR KQArialV + R KQ"ArialTraumwerks GarageR KQ"Arialr 2Z0`}. CDataObjectClient 2Z0`}. V + 3fLeft)Type text or insert image here (optional)LeftʺData Object 1 2Z0`}.((ContentsYZC00000001 C00000002%nlap;;(default);;Left;;;;FulscContUnit=====================@%scContUnit=====================@scNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 53 V + C00000003sC00000004@;Index cData Object 7 2Z0`}.(ɵfTopTopʺ<snfgpsklytkl MpsklytklnlocgnofgporschezisgpsbpPomswm<oswmxxswmpsbpPpqsnfgnofgporschepsklytklmswm<oswmxxswmrsnfgnofgporschepsklytklsmswm<oswmxxswmtpsklTitle - Text Page;;(default);;Left;;;;Ful  | psklsnfgTitlesnfgpsklytkl  TitlelocgsnfgnofgporschezisgpsklytklpsbpPcContUnit=====================@TRAUMWERKS GARAGEsqpscContUnit=====================UCurrent Projects | Favorite Links | Items for Sale | Contact Information<t<t%<,t:<A%,:AscContUnit=====================@MscNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 56 V + MiddleType content hereMiddleʺlocgsnfgnofgporschezisg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================@:Welcome to TRAUMWERKS GARAGE, Were Dreams Become Reality . scContUnit=====================@scContUnit=====================@ scNullObject===================   CDataObjectRef F\DORefProxy 51 V + HomeTRAUMWERKS GARAGEhomeMiddle dCDataObjectClientCDataObjectRef2 FF\ Embedding 1F\Data Object 7 CDORefProxy3 FF\ Embedding 2F\ ndo:Home5 FF\ Embedding 1F\Data Object 78 FF\ Embedding 3F\Data Object 63V + `@- CIndexItemC000000041;11;ContentsC00000002 1;7;ContentsC00000003 1;8;ContentsC00000001 1;ContentsContents ContentsContentshData Object 18  2Z0`}.ɵɵContentsC00000001yCDataObjectRef FF\ Embedding 1F\Data Object 1 FF\ Embedding 1F\Data Object 18 FF\ Embedding 1F\Data Object 22 FF\ Embedding 1F\Data Object 24 FF\ Embedding 1F\Data Object 23 FF\ Embedding 1F\Data Object 19 FF\ Embedding 1F\Data Object 21 FF\ Embedding 1F\Data Object 20V + - r 2Z0`}. CDataObjectClient 2Z0`}. V + 3fLeft)Type text or insert image here (optional)Leftʺlocgfsnfgnofgporschezisgnofg Arial Blackpsklytklpsklytkl pC00000002z%C00000003Index Data Object 19 2Z0`}.ɵɵsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================@911 RS PROJECTscContUnit=====================@scContUnit=====================@914-6/GT PROJECTscContUnit=====================@scContUnit=====================@ORIGINAL 914-6 scNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 11 V + MiddleType content hereMiddleʺ3nofgporschezisgpsbpBmswm#oswmFxswmpsbpCHpsbpK6psklmswm#oswmFxswmDlocgsnfgpsklytklEmswm#oswmFxswm@psklytklFytklGpsklytklIpsklytklJpsklytklLytklMpsklytklNpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================@CURRENT PROJECTSE6KscContUnit=====================@891 1 RS Project (click on the picture to take you there)scContUnit=====================@ MscNullObject===================   CDataObjectRef F\DORefProxy 10 V + Text CURRENT PROJECTSMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7 CDORefProxy FF\ Embedding 2F\ ndo:Text  FF\ Embedding 3F\Data Object 87V + p1  CIndexItemC000000031;11;ContentsC00000002 1;7;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}. V + MiddleType content hereMiddleʺ-nofgporschezisgpsbp;mswm#oswmFxswmpsbp0psklmswm#oswmContentsyC00000001C00000002 Index Fxswm<locgsnfgpsklytklmswm#oswmFxswm8psklytkl=psklytkl >psklytkl ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful Titlelocgsnfgnofgporschezisgpsklytklpsbp http://www.rennlist.com http://www.early911sregistry.orgcContUnit=====================@FAVORITE LINKS<0;scContUnit=====================@Early 91 1S Registry>scContUnit=====================@7Great site for one of the finest cars on the planet. scContUnit=====================@8scContUnit=====================@ The Rennlist=scContUnit=====================@John Dunkle has put together a great place to chat with other Porsche owners. Sign up for a digest list of you choice and get tons of useful information every day in one simple e-mail.8scContUnit=====================@scContUnit=====================@scNullObject===================   CDataObjectRef F\DORefProxy 10 V + TextFAVORITE LINKSMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7 CDORefProxy FF\ Embedding 2F\ ndo:TextV + p09       !"#$%&()*+,./Y23456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXZ[\]^_abcdefgijlmnopqrtuvwxyz{|}~ CIndexItemC000000021;11;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}. V + MiddleType content hereMiddleʺ%psklytkl 0nofgporschezisgpsbp1Data Object 20*" 2Z0`}.ɵɵContents$'yC00000001!#C00000002mswm#oswmFxswmpsbp26psbp3locgsnfgnofgporschepsklytklmswm#oswmFxswm7locgsnfgpsklytkl8mswm#oswmFxswm;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful mailto:ericscottshea@cs.com TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================@CONTACT INFORMATION836scContUnit=====================@DThe best way to get in touch is via email to ericscottshea@cs.com .%-AscNullObject===================   CDataObjectRef F\DORefProxy 10 V + TextCONTACT INFORMATIONMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7 CDORefProxy FF\ Embedding 2F\ ndo:TextV + p<  CIndexItemC000000021;11;ContentsC00000001 1;ContentsContents ContentsIndex -Data Object 21' 2Z0`}.ɵ񾓙Contents)`C00000001&(0r 2Z0`}. CDataObjectClient 2Z0`}.CDataObjectRefF\DORefProxy 11 V + MiddleType content hereMiddleʺ-nofgporschezisgpsbp5mswm#oswmFxswmpsbp0locgsnfgnofgporschepsklytklmswm#oswmC000000021 Index hData Object 22%/, 2Z0`}.񾓙񾓙Contents.sFxswm6locgsnfgpsklytklmswm#oswmFxswm;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================@ITEMS FOR SALE605scContUnit=====================@Factory Original Fiberglass 91 1 RS Front Bumper . Authenticated via fax and photos by PCA Historic Racecar Chair Dale Miller . Part numbers 91 1RS 00001L and 91 1RS 00001R molded into four neoprene mounts.scContUnit=====================scContUnit=====================@ scContUnit=====================@BAsking $975.00. Boxed and ready to ship from Sandy , Utah (84092)scNullObject===================   CDataObjectRef F\DORefProxy 10 V + TextITEMS FOR SALEMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7 CDORefProxy FF\ Embedding 2F\ ndo:Text  FF\ Embedding 3F\Data Object 88V + p;  CIndexItemC000000021;11;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient   CDataObjectC00000001+-kC00000002>Index Data Object 2351 2Z0`}.񾓙Ɠ 2Z0`}. CDataObjectRef F\DORefProxy 13F\DORefProxy 18F\DORefProxy 20F\DORefProxy 22F\DORefProxy 24F\DORefProxy 28F\DORefProxy 30 F\DORefProxy 32"F\DORefProxy 34$F\DORefProxy 36 V + MiddleType content hereMiddleʺCpsbp- locgsnfgnofgporschezisgpsklytklmswm#oswmFxswmpsbp5locgsnfg6psklytkl Dpsklytkl7psklytkl ;ibllhnlapE locgsnfgnofgporschezisgpsklytklmswm#oswmFxswmpsbp<;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;; heading 1    " $Ful Titlelocgsnfgnofgporschezisgpsklytklpsbp http://www.rennlist.org http://www.pca.orgcContUnit=====================@ RS PROJECTE- C scContUnit=====================@The RS Replica T ransformation<<scContUnit=====================@  ;scContUnit=====================@scContUnit=====================@First of all, it's a "T"... scContUnit=====================@scContUnit=====================@Ok, the opening line is for my personal justification, not intended to offend any owners of one of the most fabulous of all 91 1's, the early 91 1 "T ouring" models. It's my rational as to why I would be crazy enough to slice the rear quarter panels off a fairly decent example of such a car . So here's my story (and I'm sticking to it) "It's a T . They made lots of them. It's not a vintage "S" bla,bla, bla" the excuses go on and on.scContUnit=====================@ scContUnit===================== @ YThe "real" story is more one of the heart. Ever since my first 91 1, I've experienced "RS Fever". I've always been a fan of the early 70's era cars. The 91 1 ST , RS, RSR and the 914-6 GT's simply push all the right buttons with me. Still touted as "The Ultimate 91 1" the RS has intrigued my senses (and what's left of my sensibility) for the last 20 years. It's time I did something about it. Seeing as how I didn't have an extra $100,000 lying around the only logical choice was to start with what I had. What I had was a 1971, 91 1T . Not a bad start. The original 2.2 engine was getting a little tired but it served me well. The old 901 syncros were gone from chasing Earl Blevins around the local autocross tracks and the body was in good shape but was exhibiting a little C-Pillar disorder (read: rust bubbles). The collection of parts began. scContUnit===================== @ scContUnit===================== @ The engine actually started with an impromptu Weber 40IDA purchase. When the carburetors arrived they had 34mm venturies. I could switch to 30's and rejet the carbs but that would be about $500.00. Why not put that money towards a good 3.0 to go under those carbs. The prices were right, because there are plenty of 3.0 owners moving up to the popular 3.6 install. After a little Internet hunting I had my hands on a 3.0 SC engine. This will serve as a great starting point for my project. More on the engine later .scContUnit===================== @ scContUnit===================== @ >On to the body parts. First I needed to find the original Carrera flares. The flares from the 73 and 74 factory Carreras are a little different than the 78 and later Carrera/SC flares. While many conversions are done using popular SC flares I wanted the look to be as authentic as possible. The face of the lip is thinner on an early Carrera flare. Again, by scanning the Internet (www .rennlist.com, www .pca.org, etc.) I was able to find an individual who had a complete set of 1974 Carrera rear quarter panels. Next were the bumpers and lids. While working on another project (a 914-6 GT) I discovered the pitfalls of finding quality fiberglass. Luckily I stumbled on a supplier with great product, prices and service. A new RS front bumper , RS rear bumper , ducktail and fiberglass hood completed the body parts needed.6D7scContUnit=====================@ scContUnit=====================@With all the parts finally collected it's off to the body shop. T roy and Mike Lundquist at "Lundquist Restorations" got the nod. Being a few short blocks from my home I was able to witness the parade of concours winning cars being prepared over the years at T roy and Mike's shop. After reviewing an extensive Jaguar project on the rotisserie I knew my 91 1 found it's home. The quality of their metal and finish work is simply unequaled.scContUnit=====================@scContUnit=====================@  scContUnit=====================@scContUnit=====================@:The first order of the day was to remove the rear quarter panels in preparation for the Carrera flares. The outline of the old quarter panel was scribed on the back of the new flares and the proper size piece was cut and fitted. Next, the Carrera flares are butt welded to what's left of the original quarter panels. Butt welding is the best way to attach flares. Spot welding and flange welding can leave a thicker ridge of metal that, at times, won't "flex" with the car . A hot day in the sun and you may get some strange reflections off your new quarter panel. scContUnit=====================@scContUnit=====================@bIf you feel up to the task of "trying this at home" there's a few MIG welding basics we should cover . First; get a good MIG welder . Next, as you're working with fairly thin sheet metal you'll want to watch the heat. Those little welds make a lot of heat and they have the ability of warping your body panels. One of the best ways to deal with heat is to visualize the alphabet scribed across your welding surface. Begin welding small tack points at "A" then one at "Z" then "M" etc. This prevents you from over heating any one area at a time. Once the sheet metal portion is tacked in place begin filling the gaps with 1" to 2" welds working in the same pattern. Keep a dolly and a body hammer around at all times and make sure you work your metal into position while it's hot. Soon you'll have all the gaps filled and you're new body begins to take shape.scContUnit=====================@scContUnit=====================@  scContUnit=====================@scContUnit=====================@With the flares welded on, the body is now ready for final fit before disassembly . The rear bumper is lined up with the new flares and the mounting brackets are fine-tuned. The ducktail is adjusted at all four corners to ensure a perfect fit. Custom brackets are made for the front and rear bumpers and everything is lined up. Once everything is aligned properly the car is again disassembled.scContUnit=====================@scContUnit=====================@After disassembly , the fiberglass parts still need a little more work. Fiberglass (no matter how good it is) can be a bit wavy . It's best to let any fiberglass pieces you may have "cure" before you begin your finish process. Curing in this case meant leaving the parts out in the hot Utah summer sun and cool Utah nights for a couple of cycles. The heating and cooling process allows the fiberglass to settle into its final resting-place before filling and sanding. If properly filled and block sanded, fiberglass parts can be as smooth as the metal parts on your car . The trick is finding someone talented enough to do the job right. On this car it actually required leaving some of the parts mounted on the car so the final stress on the glass is exhibited (yes, trunk latches can pull your body panels out of shape). I cannot say enough about the experience of T roy Lundquist at this point. It's those little tips and tricks that make a flawless paint job. The parts are primed then block sanded looking for highs and lows. Then it's primed again and the entire car gets block sanded and the prep goes on (and on). Prep is all a great paint job is about and T roy is the prep master . Roughly two days were spent just prepping the body for paint.scContUnit=====================@scContUnit=====================@  scContUnit=====================@scContUnit=====================@ Finally , the day comes when the paint is applied. For this car a sealer coat was applied first. This prevents some of the original paint from lifting when applying the initial color coat. Four color coats and three clear coats followed the sealer . After each coat, the car got a "once over" to make sure things were in order and there were no dirt and dust particles in the paint. The final finish was wet sanded with 1500 grit paper and buffed to a shine.scContUnit===================== @!scContUnit=====================!@"  scContUnit====================="@#!!scContUnit=====================#@$""fA final buffing and application of the "Carrera" graphics is the only step that awaits this car . We'll need to let the paint breath (solvents in the paint take a while to dissipate) for about a month before we can ensure the graphics will have a permanent bond. That will give us time to get the interior is finished and the w9=7indows reinstalled. Speaking of future projects, there's plenty more to come. There's a 915 transmission on the bench and the 3.0 SC engine on the stand. The 915 will get a thorough rebuild and the 3.0 will get an extensive top-end overhaul including a CIS to MFI swap. Stay tuned.scContUnit=====================$@##scNullObject===================Ref F\DORefProxy 10 V + Text RS PROJECTMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7  CDORefProxy FF\ Embedding 2F\ ndo:Text  FF\ Embedding 3F\Data Object 92 FF\ Embedding 3F\Data Object 121 FF\ Embedding 3F\Data Object 123 FF\ Embedding 3F\Data Object 125 FF\ Embedding 3F\Data Object 127 FF\ Embedding 3F\Data Object 131 FF\ Embedding 3F\Data Object 133  FF\ Embedding 3F\Data Object 135" FF\ Embedding 3F\Data Object 137$ FF\ Embedding 3F\Data Object 139V + p3 CIndexItemC000000021;11;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}. V + 3fLeft)TContents4C0000000102C000000023C00000003ype text or insert image here (optional)Leftʺ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================@:Overview on the task of refinishing classic Fuchs alloys.scNullObject===================   CDataObjectRef F\DORefProxy 20 V + TextREFINISHING FUCHS We start by saying that these wheels are not only some of the strongest and lightest wheels available but, the anodized finish th 2Z0`}. CDataObjectRefF\DORefProxy 11F\DORefProxy 13F\DORefProxy 15F\DORefProxy 17F\DORefProxy 19F\DORefProxy 25F\DORefProxy 26 F\DORefProxy 28"F\DORefProxy 30$F\DORefProxy 32&F\DORefProxy 34(F\DORefProxy 36 V + MiddleType content hereMiddleʺ ?psbpA- locgsnfgnofgporschezisgpsklytklmswm#oswmFxswmpsbp2snfgzisgmswmoswm2xswmd3snfgzisgmswmoswm2xswmd4snfgzisgmswmoswm2xswmd6snfgzisgmswmoswm2xswmd78snfgzisgmswm#oswmFxswm9zisgmswmoswm2xswmd:;<=snfgzisgmswmoswm2xswmd>snfgzisgmswm#oswmFxswmBlocgsnfgnofgporschezisgpsklytklpsbpCmswm#oswmFxswm5;;(default);;Left;;;;;;(default);;Left;;;; heading 1   " $ & (Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================@REFINISHING FUCHS WHEELSC-AscContUnit=====================@$Refinishing the Classic Fuchs Alloy55scContUnit=====================@ scContUnit=====================@= Pile of wheels waiting to be finished.2scContUnit=====================@scContUnit=====================@pAs the earliest Fuchs forged alloy now hits 35 years of age it seems that an article on refinishing these classic wheels might come in handy . A car that has been a daily driver will no doubt exhibit a little wear and tear on the now aging wheel. I've performed this process a number of times and I've broken it down into a fairly easy to follow step by step process.scContUnit=====================@scContUnit=====================@ SLet me factory selected, has made them some of the most durable. Y ou may choose to sway from the original "anodized" course for cosmetic reasons but you'll be an informed owner (more on that later) if you do. scContUnit===================== @ scContUnit===================== @ %On my most recent project I refinished a total of 13 Fuchs wheels. The process involves a few simple steps that are a bit more elaborate than the standard alloy wheel refinishing job due to one thing anodizing. Let's begin with a little history that takes us up to the anodizing process. scContUnit===================== @ scContUnit===================== @ Y our Fuchs wheels are some of the first and only "forged" wheels on the market. Most wheels are cast making them inherently weaker than a forged wheel. A forged wheel is literally pounded out of a single block of alloy making it one of the strongest wheels available. scContUnit===================== @ scContUnit=====================@ Once the rough metal is finished the wheel is anodized to protect it. Anodizing is an electrostatic process, which in a simplified explanation corrodes the outer surface of the wheel. It's this corroded layer which helps protect the finish underneath. The wheel is still pourus, which is why the factory recommends only certain types of cleaners and an annual dose of petroleum jelly . It should be noted that anodizing dulls the finish of a polished wheel. As mentioned earlier , some people forego the anodizing process in favor of a very high shine when refinishing their wheels. This is perfectly fine for wheels that won't see the elements however , not recommended for a daily driver .scContUnit=====================@scContUnit=====================@After anodizing the factory would actually "dip" the wheel into a vat of paint. This dipping process is what left a perfectly level line around the edge of the early polished paddle Fuchs wheel. This is evident by the entire backside of a stock Fuchs wheel being painted black. The freshly painted wheel would then go through a drying oven and the outcome was a finished Fuchs alloy .scContUnit=====================@scContUnit=====================@sSo how do we undo what the factory did and then attempt to redo it again? That's what this article is all about:scContUnit=====================@scContUnit=====================@Step 1: Y ou have to get the crud off your wheels. Old, bad paint, duct tape and a multitude of surface scratches can be some of the things marring your finish. I've heard some pretty funny stories about stripping wheels such as; "put brake fluid on them" or , "try Oven-Off". In the past I tried a standard household paint stripper to no avail. That black paint wouldn't come off. Most paint stripping shops wanted about $40-$50 per wheel and that didn't seem right. I might have the paint off but what about those scratches. Plastic media blasting was my first option. This got everything off but left the wheels in a fairly rough state. They needed to be polished to bring back the factory luster . Y ou also have to be very careful not to use a media that is too abrasive. This can literally make your wheels un-polishable. Do not use standard sand blasting media. I'd recommend plastic or walnut media. I've also tried a chemical bath (be careful it has to be done by someone who knows what they're doing.) This process takes a very short period of time in the tank just long enough for the anodizing and paint to be etched off. If you have them chemical stripped I would recommend Joe at Crown Plating in Salt Lake City . Joe is a 91 1 owner and he knows what it takes to do it right. The benefit of chemical stripping is that it can remove paint and anodizing in one step. Plastic Media Blasting -or- chemical bath. I've done them both and each works fine.scContUnit=====================@scContUnit=====================@  scContUnit=====================@T Dipping tank Stripped Wheel3scContUnit=====================@scContUnit=====================@"Step 2: Polish? Maybe. If you used the chemical bath then you're ready to hit the polishers. If you used the plastic or walnut media blasting chances are your wheels still have a layer of anodizing to go through. Y ou cannot polish an anodized wheel until you de-anodize it. So, if you used the media blasting method in step 1 then step 2 is "de-anodize the wheel". If your wheels don't have any major scratches then you may want to jump ahead to this step. Find a local anodizer , many of them have stripping facilities to remove the paint before they de-anodize your wheels. De-anodizing is a "hot-bath" process that takes about 15 minutes for a set of 5 wheels. Y ou may want to leave them off for a day because the wheels get very hot and they'll need about 1/2 hour to an hour to cool down.scContUnit=====================@scContUnit=====================@dStep 3: Polish. This is where you get the choice. If you want your wheels to have a "factory" appearance you'll have to compensate for the upcoming anodizing process in this polishing step. Y ou'll want to have your wheels polished to a higher luster then you would actually want on your finished product. Remember , anodizing is actually a corrosion process that will slightly dull the finish of your wheels. I chose to have the factory "anodized" look on a few wheels and had them polished to a fairly high luster . On others I chose to have the polished look on and left them de-anodized. Y ou can also have any remaining surface scratches taken out at this time. It helps if your anodizer understands what finish you expect as well. The fine folks at Metal Masters in Salt Lake City got the nod for the polishing work, they do a fabulous job on Fuchs alloys.scContUnit=====================@scContUnit=====================@  scContUnit=====================@g A painted center wheel after being polished A classic polished spoke wheel after being polished4scContUnit=====================@ scContUnit===================== @!Step 4: Anodizing, or should we say re-anodizing? Now that the wheels are polished it's time to have the anodizing process applied to your alloys (if that's the look you're going for .) Anodizing is a phenomenal finish for an alloy wheel. It cures and protects the surface without the threat of ever peeling off like many wheels finished with "clear coat" paint. It leaves the alloy porous and ready to paint. Ever wonder why the factory recommends only certain pH balanced cleaners? Now you know . A harsh chemical cleaner can make it's way into the surface of your alloy permanently damaging your wheel. Anodizing is, once again, an electrostatic "hot-bath" process. Plan on leaving your wheels for a day . scContUnit=====================!@" scContUnit====================="@#!!CStep 5: T aping and Painting. As discussed earlier , the original early Fuchs alloys were "dipped" in paint. The wheel entered the paint tank from the backside and they dipped the wheel just enough so the paint came to the bottom of the spokes (polished spoked Fuchs). The later models with deeper offsets were dipped further , covering the entire spokes. This "dipping" process has a very even and unique look... a look that would be hard to duplicate. Part of me hated to give in. I know the factory dipped the wheels and I wanted to do these things right. Well, I gave in. Y es, the factory dipped the wheels. They dipped them because for a "factory" making hundreds of wheels it was probably the most economical way . Dipping was cost effective, fast and accurate. Dipping for us would not be as "cost effective". Automotive grade satin black paint was about $60 to $70 per gallon and as I figured it you would need about 5 gallons. T aping and spraying was my only alternative. This is what nearly every wheel re-finishing shop does so don't feel as if you're cheating yourself.scContUnit=====================#@$""scContUnit=====================$@%##  scContUnit=====================%@&$$R Classic polished paddle wheel with 3M tape Painted center wheel with 3M tape.6:scContUnit=====================&@'%%scContUnit====================='@(&&One measure you can take to ensure a proper result is to use the proper 3M masking tape for the job. It may be harder to find it but it's more then worth it. The proper tape is vital to getting a perfect result. This is a two step taping process that involves using this small and flexible 3M masking tape (1/4" wide blue vinyl tape. Look for it in auto body supply stores) and then going over the edges with the larger 2" standard masking tape. T ake your time! This is one of the most crucial steps in finishing your new wheels.scContUnit=====================(@)''6:scContUnit=====================)@*((  scContUnit=====================*@+))c Painted center all taped up and ready for paint. Classic polished paddle wheel taped and ready .=:scContUnit=====================+@,**=;scContUnit=====================,@-++After careful taping you can now start the painting process with your new wheels. For a custom polished look most people recommend a gloss black to match the highly polished finish. If you're looking for a factory finish you'll want to use a semi-gloss or satin finish. Many people have recommended the Wurth Satin Black spray can product for this step. Some have used "heat paint" due to the high heat conditions some wheels can be subject to under hard braking. Others recommend a good automotive grade paint purchased at a paint supply store. The choice is yours. I must reiterate, take your time and tape your wheels right the first time. Use the right tape and the right paint. Y ou're going to have to live with these wheels a long time.scContUnit=====================-@.,,7;scContUnit=====================.@/--Step 6: Curing your paint. Now that you've got your paint on your wheels it's time to cure it. Read the label on the paint first. Some paints don't respond well to curing. Curing requires an oven large enough to handle your wheel. My oven was about 2" too shallow ... what are friends for? Over to my friend house who's oven measured a perfect fit. We baked each wheel for 1 hour at 550 degrees. The wheels came out looking rather "dusty" or "oxidized". I knew right then we did the right thing. Remember when we were discussing anodizing, the surface is still rather porous. The curing process "baked" the paint into the surface of the wheel. Make certain you use proper ventilation during this step. Paint fumes can be "very" toxic.scContUnit=====================/@0..7;scContUnit=====================0@1//Step 7: V aseline. That's right V aseline (or any other fine petroleum jelly). Read the factory manual. They recommend periodic maintenance of rubbing V aseline on your Fuchs alloys. This helps close off the porous alloy left in the anodizing process. The curing process left the wheels with a very "flat" black oxidized look to the paint. By taking V aseline to the entire wheel and rubbing it into the paint and the open porous alloy spokes, the wheels came to life. The original satin finish was staring me in the face. This was a dead-on factory look! I took a key to some overspray on the inside of the wheel to test it's durability ... you couldn't scratch it off. The process was done.scContUnit=====================1@200>scContUnit=====================2@311The Finished Product>scContUnit=====================3@4228<scContUnit=====================4@533 7;scContUnit=====================5@644E Polished Spokes. Full Polish. Painted Centers9<scContUnit=====================6@7558<scContUnit=====================7@866There you have it. The final run down on what to expect in a do-it-yourself Fuchs alloy restoration. The resulting pride in looking at your finished product goes much deeper then ever expected. Some final comments; De-anodize before you attempt to polish. Re-anodize before you paint, and take your time in taping off your lines. Use the right materials and you'll get the right results. The best of luck!scContUnit=====================8@778<scNullObject===================HEELSMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7  CDORefProxy  FF\ Embedding 3F\Data Object 96  FF\ Embedding 3F\Data Object 98 FF\ Embedding 3F\Data Object 100 FF\ Embedding 3F\Data Object 102 FF\ Embedding 3F\Data Object 104 FF\ Embedding 2F\ ndo:Text FF\ Embedding 3F\Data Object 106 FF\ Embedding 3F\Data Object 108 FF\ Embedding 3F\Data Object 110 FF\ Embedding 3F\Data Object 112  FF\ Embedding 3F\Data Object 114" FF\ Embedding 3F\Data Object 116$ FF\ Embedding 3F\Data Object 118V + pP7  CIndexItemC000000031;11;ContentsC00000002 1;7;ContentIndex Data Object 247 2Z0`}.ƓƓContents:C0000000168sC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}. V + TopTopʺ@locg33snfgpsklytkl Jlocg33pskl[psklytklipsapPk C000000029 C00000003pIndex  Embedding 2Y 2Z0`}.Ɠ Llocgnofgporschezisghpsklytklmswm-oswmZxswmpsapPllocg33snfgpsklytkl Title - Text Page;;(default);;Left;;;;;;(default);;Left;;;;Ful  | locg33psklsnfgTitlelocg33snfgpsklytkl cContUnit=====================@!TRAUMWERKS GARAGE | homek[icContUnit=====================@CURRENT PROJECTS | RS PROJECT | S SUSPENSION UPGRADE | REFINISHING FUCHS WHEELS | F A VORITE LINKS | ITEMS FOR SALE | CONT ACT INFORMA TION @J@J!l(J<@CJ[@bJp@wJ@ !(<C[bpwscContUnit=====================@scNullObject===================   CDataObjectRef F\DORefProxy 28 V + TextS SUSPENSION UPGRAD      !"#$%&'()*+,-./01234568:N;<?>@AJBCDEFGHIKQLMOcPRSTVUWbXYZ[\]^_`adeyfhginjklmoupqrstvwx}z{| 2Z0`}. CDataObjectRef F\DORefProxy 11 F\DORefProxy 13F\DORefProxy 15F\DORefProxy 17F\DORefProxy 19F\DORefProxy 23F\DORefProxy 25F\DORefProxy 27"F\DORefProxy 30$F\DORefProxy 32 V + MiddleType content hereMiddleʺ6psbp+ locgsnfgnofgporschezisgpsklytklmswm#oswmFxswmpsbp7 locgsnfgnofgporschezisgpsklytklmswm#oswmFxswmpsbp1;;(default);;Left;;;;;;(default);;Left;;;; Heading 1 heading 2     " $Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================@S SUSPENSION UPGRADE7+6scContUnit=====================@#Front Brake and Suspension UpgradescContUnit=====================@Baby Gets Some New Shoes11scContUnit=====================@scContUnit=====================@Y et another in what will probably be a never-ending string of fixer-uppers and improvements to the 91 1RS clone. One of the things the factory did with nearly every substantial increase in horsepower was to equally increase the stopping power of their cars. This first happened in 1967 with the 91 1S, it was the first to receive vented rotors on all four corners. Then in 1969 the 91 1S received the lighter and larger aluminum caliper . The 1973 RS was no different. It received the 91 1S brakes including the aluminum calipers. The following little article will take you through the process of updating a 1971 T (M-Strut car) to a full 1973 RS A-Strut, S-Caliper front suspension.scContUnit=====================@scContUnit=====================@If you're the owner of an early 91 1 with the standard M-Strut configuration this may be of interest to you. Most early 91 1's were fitted with the M-Strut. In 1969 the 91 1S received the A-Strut which utilized a 3.5" spacing for the new aluminum caliper . The desirable A-Strut is also a launching pad for other exotic brake applications. Later T urbo, 917 and Big Red calipers all simply bolt on to the 3.5" A-Strut. An M-Strut leaves you with little or no option in upgrading your 91 1's braking performance. Seeing as how this car is awaiting its new 3.0 MFI engine I felt it mandatory to improve the brakes and suspension before ever being tempted to turn the key .scContUnit=====================@ scContUnit===================== @    scContUnit===================== @ scContUnit===================== @ The first step is to find an A-Strut assembly that doesn't cost you an arm and a leg good luck! They're out there but the people who have them generally know what they're worth. For me the A-Strut upgrade was important on two fronts; a) for performance reasons, as stated earlier , the car would be getting a substantial increase in horsepower (nearly double it left the factory with), and b) for nostalgic reasons this car needed to have the original RS suspension package. The hunt began. A local friend (and 91 1 addict) just so happened to have such a system. It took nearly all summer to work out an amicable trade but it finally happened. He got the SSI heat exchangers (I needed new ones for the MFI system) and I got the A-Struts with the proper S-Calipers. The struts were a little rough and the calipers were in need of a cleaning, new stainless steel pistons and a good rebuild. So goes the story of this project.scContUnit===================== @ scContUnit===================== @   scContUnit=====================@ scContUnit=====================@The rebuilding process began with the struts. The previous-previous owner had the spindles raised the proper 18mm (.71"). This was a "good thing" as some RS's and all RSR's had this option performed at the factory . This effectively lowered the car and retained the proper suspension travel without lowering the roll center . The bad thing was the quality of the work performed. Although the welds looked solid and substantial they also looked a bit sloppy . The brake hose mount was also moved up and subsequently bored out (with a jackhammer) to a size one would suspect was needed for a racing application. The first step was to get these struts down to bare metal. A trip to the local sandblaster made my wallet an easy $10 bucks lighter and got my struts down to bare metal (well worth the investment.) Then it was off to Mike Lundquist of Lundquist Restorations to have the welds cleaned up and the holes brought back into their proper specs. A couple coats of primer and a few more of "Koni" orange and "viola" new A-Struts. With the struts finished it's a simple matter of screwing in the new Koni inserts and adjusting them to the desired ride quality . T otal restoration cost so far $78.00scContUnit=====================@scContUnit=====================@  scContUnit=====================@ scContUnit=====================@scContUnit=====================@Next I was off to restore the calipers. The aluminum calipers bore the same anodized finish that comes on our Fuchs wheels. Being beneath the car and constantly exposed to the elements anodizing was the best solution to keep these new (back in 1973) aluminum parts from corroding. Mine had seen better days and this meant they needed to be de-anodized, cleaned and polished and then re-anodized to complete the restoration. The first order of the day was to completely dismantle the caliper . This meant removing all the bleeder valves, cross-over lines and the piston covers. All the parts that needed replating and restoring were gathered together and taken to Pilkington Metal Finishing in Salt Lake City .scContUnit=====================@scContUnit=====================@Once the calpiers are back from the metal finishers it's time to put them back together again. The early S-calipers came with standard steel pistons. These would tend to rust making the caliper stick and bind. Y ou may have experienced your car pulling to one side under braking. Once a piston has rusted it can't be used again. Answer? Stephen Stomski of Stomski Racing. Stephen makes replacement pistons for the S-caliper out of stainless steel. These are artfully machined and will never rust. Stephen is a PCA member and a pleasure to do business with. The piston kit not only comes with the 4 pistons needed it also includes new stainless steel pad retaining pins and rebuild kits. Quite the bargin.scContUnit=====================@scContUnit=====================@  scContUnit=====================@scContUnit=====================@{On to the caliper rebuild. The factory suggests a thin coat of A TE brake cylinder paste on the cylinder bore, piston and piston seal to make reassembly easier and to provide protection against corrosion. Others have suggested simply using clean brake fluid. The first step after lubricating the parts is to install the piston seal into the groove in the cylinder bore. Next is to install the piston. There are two main points to this step; 1) Position the piston properly in the bore. This is done using the factory tool P 84 (or a piece of heavy single ply cardboard with a 20-degree angle made to duplicate the factory tool). The "stepped-down" surface of the piston must point toward the disc's rotation at this 20-degree angle. 2) Don't jam it! The piston must go in evenly with little or no resistance. Once the pistons are in you can install the new dust covers. These must be dry when installing them. Wipe all the brake fluid or assembly paste from the ridge before installing the covers. Now is a good time to recheck the position of the piston in the caliper . Position the dust cover , install the snap ring and your done.scContUnit=====================@scContUnit=====================@Work in progress...scContUnit=====================@scNullObject===================EMiddle dCDataObjectClientCDataObjectRef FF\ Embedding 1F\Data Object 7  CDORefProxy  FF\ Embedding 3F\Data Object 143  FF\ Embedding 3F\Data Object 145 FF\ Embedding 3F\Data Object 147 FF\ Embedding 3F\Data Object 149 FF\ Embedding 3F\Data Object 151 FF\ Embedding 3F\Data Object 154    r!#$%&'()+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`acdefhijkmnopqstuvwyz{|}~ FF\ Embedding 3F\Data Object 156 FF\ Embedding 3F\Data Object 158 FF\ Embedding 2F\ ndo:Text FF\ Embedding 3F\Data Object 160  FF\ Embedding 3F\Data Object 162V + sp5  CIndexItemC000000031;11;ContentsC00000002 1;8;ContentsC00000001 1;ContentsContents Contents CDataObjectClient  V +-Text r 2Z0`}. CDataObjectClient 2Z0`}.V +Leftdd Contents$Data Object 69<KA 2Z0`}.Ɠ`ϓContentsJxC00000001>@C00000002xC00000003?EC00000004yC00000005BDz 2Z0`}.CDataObjectRefF\DORefProxy 23V +fTop__33ff 2Z0`}.V +Rightdd  2Z0`}.V +BottomC00000006 zC00000007CG"C00000008* C00000009FHb" 2Z0`}.?V +Middle 2Z0`}. V + R KQ8 MS Sans SerifLeftLeftʺ dnilpsklytklibllimnlibrlnlappsbp@ psklytklnlappsbp@FulscContUnit=====================cscNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 25F\DORefProxy 26F\DORefProxy 27F\DORefProxy 28 V + fR KQ8 MS Sans SerifTopType text hereTopʺ !locgsnfgGlocg33nofgTimes New Romanzisgmswmoswm2xswmdIlocg33nofgTimes New RomanzisgpsklytklKlocg33nofgTimes New Romanzisg]psbpd5psklytklnlapWpsklytklBlocgsnfgzisgpsklytkl^ibllpsbp(dnipmnlp_ibll`ibllWdnipmnlpaiblleibll@ dnipmnlpRpsklytklSpskl ytkl\psklytklpsbp(b locgsnfgzisgpsklytklmswm#oswmFxswmpsbpcpsklflocgsnfgzisgpsklytklpsbpgmswm#oswmFxswmhpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;   FulTitlelocgsnfgzisgpsklytklpsbp Titlelocgsnfgzisgpsklytkl cContUnit=====================c"Title of Home Page | homegGKIdcContUnit=====================c#  Title of Current Page W5\5RS  B e scContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifRightRightʺFulscContUnit=====================cscNullObject=================== 2Z0`}. V + R C0000000AIg$C0000000BltIndex Data Object 70O 2Z0`}.`ϓ`ϓKQ8 MS Sans SerifBottomBottomʺFulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleMiddleʺdnilibllimnlibrlpsbpFulscContUnit=====================cscNullObject===================    V + Container PageMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 69 FF\ Embedding 3F\Data Object 70 FF\ Embedding 3F\Data Object 73 FF\ Embedding 3F\Data Object 68V + `!P  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefF\ DORefProxy 8V +3fContentsXjC00000001LNC00000002C00000003MSLeft f 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +TopZZ 33ff 2Z0`}.V +3fRight fC00000004yC00000005PRzC00000006zC00000007QU 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle 33ff 2Z0`}. V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺlocgfsnfglocg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + TopTopʺ@locg33snfgpsklytkl JC00000008#C00000009TVyC0000000AWRC0000000Blocg33psklKlocg33snfgpsklytkl [psklytklipsapPj locgnofgporschezisghpsklytklmswm-oswmZxswmpsapPkpsklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;Ful   | locg33psklsnfgTitlelocg33snfgpsklytkl cContUnit=====================c!TRAUMWERKS GARAGE | homek[icContUnit=====================cyFirst Title of This Page's Sequence | Second Title of This Page's Sequence | Third Title of This Page's Sequence@J#K*JN@U##*$NU#scContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + MiddleType content hereMiddleʺ  psbppsbppsbppsbp#psbp$)psbp*&locgsnfgnofgporschezisgpsklytklpsbp'mswm#oswmFxswm+snfg,locgsnfgnofgporschezisgpsklytklpsbp-mswm#oswmFxswm.psklytklpsklpsklytklpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;; Heading 1Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpcContUnit=====================cTitle of Current Page-+*scContUnit=====================cscNullObject===================    V + TextMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65V + c  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContIndex Data Object 71=u] 2Z0`}.`ϓ[דContentsfYjC00000001Z\S    !"#$%&'()*+,-./01245678:;<=>@ABCDEFGHIJKLMNOPQRTUVWXZ[\]^`abcdefghklmopqsuwyz{|}~entsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefF\ DORefProxy 8V +3fLeft fC00000002C00000003[a C00000004 yC00000005^`z 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +TopZZ 33ff 2Z0`}.V +3fRight f 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle 33ff 2Z0`}. V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺlocgfsnfglocg;;(default);;Left;C00000006zC00000007_cC00000008C00000009bd3y;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + TopTopʺppsbpPuvpsbpPqlocgnofgArialzisgpsbpPsnofgArialpsklytklmswm<oswmxxswmtpsklwpsklytklxmswm<oswmxxswmylocgsnfgnofgporschezisgzsnfgnofgporschepsklytkl{mswm<oswmxxswm|psklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlelocgsnfgnofgporschezisgpsklytklpsbpPcContUnit=====================cTitle of Current Page{yvscContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R C0000000Ae9RC0000000B?Index _Data Object 72k 2Z0`}.[ד@KQ8 MS Sans SerifMiddleType content hereMiddleʺ  psbppsbppsbppsbp#psbp$%psbp()psbp locgsnfgzisgpsklytklpsbp!mswm#oswmFxswm&psklytkl'psklpsklytklpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;; Heading 1;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V + HomeMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefF\ DORefProxy 8V +3fLeftf 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +Contentst.C00000001hjiC00000002jC00000003ionTopZZ 33ff 2Z0`}.V +3fRight f 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle 33ffC00000004ryC00000005lntzC00000006vzC00000007mqx 2Z0`}.CDataObjectRefF\ DORefProxy 9F\DORefProxy 10F\DORefProxy 11F\DORefProxy 12 V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺ locgfsnfgpsklytklX psklytklpsklytklpsklytklpsklytklpsklytklpsklytklpsklytklnlap;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulcContUnit=====================c        cContUnit=====================cscContUnit=====================cscNullObject=================== 2Z0`}. V + R C00000008aC00000009pryC0000000AsRC0000000BKQ8 MS Sans SerifTopTopʺapsbpPejpsbpPkElocg33psklytklHlocg33[ locgsnfgnofgArialzisgpsklytklmswm<oswmxxswmpsbpPbpsklfytklgpsklcpsklytkllpsklytklmppsklytklqdsnfgnlocgsnfgnofgArialzisghpsklytklpsbpPomswm-oswmZxswmTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgnofgArialzisghpsklytklpsbpPTitlepsklytklcContUnit=====================c"Title of Home Page | homeoHEkcContUnit=====================cback to Title of Up Leveldc  scContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleType content hereMiddleʺ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V + Detail - Arrow NavigationMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65  FF\ Embedding 3F\Data Object 66  FF\ Embedding 3F\Data Object 67  FF\ Embedding 3F\Data Object 71  FF\ Embedding 3F\Data Object 72V + `Index Data Object 73gy 2Z0`}.@@Contents^jC00000001vx  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefF\ DORefProxy 8V +3fLeft f 2Z0`}.&CDataObjectRefC00000002C00000003w}C00000004yC00000005z|zF\ DORefProxy 6V +TopZZ 33ff 2Z0`}.V +3fRight f 2Z0`}.V +Bottom33ff 2Z0`}.>V +MiddleC00000006zC00000007{C00000008MC00000009~7y 33ff 2Z0`}. V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺlocgfsnfglocgpsklytkl snfgpsklytkl  psklytkl        !"#$%&'()*+,-./012345689:;<>?@ABDEFGHIJKLMNOPQRSTUVWYZ[\]_`abcefghijklmpqrtuvxz|~psklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;Ful   psklsnfgTitlesnfgpsklytkl cContUnit=====================c$First Title of This Page's Sequence##cContUnit=====================c%Second Title of This Page's Sequence$$cContUnit=====================c$Third Title of This Page's Sequence##scContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifTopTopʺapsbpPefpsbpPkElocg33psklytklHlocg33[ locgsnfgnofgArialzisgpsklytklmswm<oswmxxswmpsbpPbpsklcpsklytklgpsklytklhdsnfgilocgsnfgnofgArialzisghpsklytklpsbpPjmswm-oswmZxswmlpsklytklmnpsklytklTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgnofgArialzisghpsklytklpsbpPTitlepsklytklcContUnit=====================c"Title of Home Page | homejHEkcContUnit=====================cback to Title of Up Leveldc  scContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(defaultC0000000A=RC0000000BC Index dData Object 74 2Z0`}.@`$蓙);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleType content hereMiddleʺ  psbppsbppsbppsbp#psbp$%psbp(*psbp locgsnfgzisgpsklytklpsbp!mswm#oswmFxswm&psklytkl')psklytklpsklpsklytklpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;; Heading 1;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V + Detail - Title NavigationMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefContentsjC00000001nC00000002oC00000003sF\ DORefProxy 8V +3fLeft f 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +TopZZ 33ff 2Z0`}.V +3fRightC00000004wyC00000005yzC00000006{zC00000007} f 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle 33ff 2Z0`}. V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)LeftʺYlocgfsnfglocg;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifTopTopʺC00000008 C00000009yC0000000ARC0000000B9psbp<ApsbpBCDpsbpPNPpsbpPQUpsbpPVWpsbpP\]psbpP^bpsbpPc5 locgsnfgzisgpsklytklmswm<oswmxxswmpsbp:pskl;psklytklElocg33FpsklytklGHlocg33Ilocg33snfgpsklytkl RlocgnofgArialzisgpsklytklpsbpPSmswm<oswmxxswmTpsklytklXYpsklytkl_locgsnfgnofgArialzisghpsklytklpsbpP`mswm-oswmZxswmapsklytkldTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgnofgArialzisghpsklytklpsbpPcContUnit=====================c"Title of Home Page | home`HEcscContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleType content hereMiddleʺ  psbppsbppsbppsbp#psbp$%psbp(locgsnfgzisgpsklytklpsbpmswm#oswmFxswmsnfg locgsnfgzisgpsklytklpsbp!mswm#oswmFxswm&psklytkl'psklpsklytklpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;; Heading 1;;(default);;Left;;;;Ful TitlelocgsnfgzisgpsklytklpsbpcContUnit=====================cTitle of Current Page!(scContUnit=====================cscNullObject===================    V + Text - No NavigationMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65V + `  CIndexItemC0000000A1;10;CIndex Data Object 75 2Z0`}.`$蓙 LContents_.C00000001ontentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefF\ DORefProxy 8V +3fLeftf 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +C00000002C00000003C00000004yC00000005zTopZZ 33ff 2Z0`}.V +3fRight f 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle 33ffC00000006zC00000007SC00000008] C000000090y 2Z0`}. V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺnlappsklytklnlappsklytklnlappsklytklnlap psklytklnlap psklytkl;;      !"#$%&'()*+,-./12345789:;=>?@ABCDEFGHIJKLMNOPQRSTUVWXZ[\]^`abcdefghijkmnopqrstuxyz|}~(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulcContUnit=====================cscContUnit=====================c scNullObject=================== 2Z0`}.CDataObjectRefF\DORefProxy 14F\DORefProxy 15F\DORefProxy 17F\DORefProxy 18 V + R KQ8 MS Sans SerifTopTopʺ gpsbpPElocg33psklytklhpsklytklHlocg33` locgsnfgnofgArialzisghpsklytklmswm-oswmZxswmpsbpPinlapjpsklytklnlapkpsklytklnlaplpsklytklnlapmpsapnpsklytklpsapopsklytklpqpsklytklpsapTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;FulTitlelocgsnfgnofgArialzisghpsklytklpsbpPcContUnit=====================c"Title of Home Page | home`HEgcContUnit=====================c    qiji k inmscContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺC0000000A6RC0000000B<Index lData Object 76 2Z0`}. L L;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleType content hereMiddleʺ  psbppsbppsbppsbp#psbp$%psbp()psbplocgsnfgzisgpsklytklpsbpmswm#oswmFxswmsnfg locgsnfgzisgpsklytklpsbp!mswm#oswmFxswm&psklytkl'psklpsklytklpsklytklpsklytkl;;(default);;Left;;;;;;(default);;Left;;;; Heading 1;;(default);;Left;;;;Ful TitlelocgsnfgzisgpsklytklpsbpcContUnit=====================cTitle of Current Page!)scContUnit=====================cscNullObject===================    V + Text - Arrow NavigationMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65 FF\ Embedding 3F\Data Object 66 FF\ Embedding 3F\Data Object 67 FF\ Embedding 3F\Data Object 71 FF\ Embedding 3F\Data Object 72V + `  CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents Contentsr 2Z0`}. CDataObjectClient 2Z0`}.&CDataObjectRefContents.C00000001vC00000002wC00000003{F\ DORefProxy 8V +3fLeft f 2Z0`}.&CDataObjectRefF\ DORefProxy 6V +TopZZ33ff 2Z0`}.V +3fRightC00000004yC00000005zC00000006zC00000007 f 2Z0`}.V +Bottom33ff 2Z0`}.>V +Middle(33ff 2Z0`}.CDataObjectRefF\ DORefProxy 9F\DORefProxy 10F\DORefProxy 11F\DORefProxy 12 V + 3fR KQ8 MS Sans SerifLeft)Type text or insert image here (optional)Leftʺnlappsklytklnlappsklytklpsklytklnlap psklytklnlap psklytklnlap psklytkl;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulcContUnit=====================c      scContUnit=====================# scNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifTopTopʺ9psbp<ApsbpBCDpsbpPNPpsbpPQUpsbpPVWC00000008 C00000009yC0000000ARC0000000BpsbpP\]psbpP^apsbpPb5 locgsnfgzisgpsklytklmswm<oswmxxswmpsbp:pskl;psklytklElocg33FpsklytklGIlocg33snfgpsklytkl RlocgnofgArialzisgpsklytklpsbpPSmswm<oswmxxswmTpsklytklXYpsklytklZlocgsnfgnofgArialzisgpsklytklpsbpP[mswm<oswmxxswm_psklytkl`clocgnofgArialzisgmswm2oswmxxswmpsbpPdpsklytklepsklfytklgzisghmswmZoswmxswmhizisgpsklytkljmswmZoswmxswmhkpsklytkllTitle - Text Page;;(default);;Left;;;;;;(default);;Left;;;;Ful TitlezisgpsklytklcContUnit=====================cT itle of Current PagejhbscContUnit=====================cscNullObject=================== 2Z0`}. V + 3fR KQ8 MS Sans SerifRight)Type text or insert image here (optional)Rightʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifBottomBottomʺ;;(default);;Left;;;;FulscContUnit=====================cscNullObject=================== 2Z0`}. V + R KQ8 MS Sans SerifMiddleType content hereMiddleʺ;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;;;(default);;Left;;;;FulscContUnit=====================cscNullObject===================    V +  PresentationMiddledCDataObjectClient CDORefProxy FF\ Embedding 3F\Data Object 64 FF\ Embedding 3F\Data Object 65  FF\ Embedding 3F\Data Object 71  FF\ Embedding 3F\Data Object 66  FF\ Embedding 3F\Data Object 67  FF\ Embedding 3F\Data Object 72V + `Index Embedding 3;Kb 2Z0`}. L`cContentsPKData Object 63` 2Z0`}. L   CIndexItemC0000000A1;10;ContentsC0000000B1;11;ContentsC00000002 1;2;ContentsC00000003 1;3;ContentsC00000004 1;4;ContentsC00000005 1;5;ContentsC00000006 1;6;ContentsC00000007 1;7;ContentsC00000008 1;8;ContentsC00000009 1;9;ContentsC00000001 1;ContentsContents ContentsCDataObjectClientEFGHIJKLV +-Text ContentsImage1`Data Object 64` 2Z0`}.Contents XJFIF,,C     C   " }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?s [Hw#pl%A3ӨwǷϩj P1@8^~mw?[nM7nqH~)|9'=6x/󻃖'ܜd| ѯ RAXq 5It%\Ug‘8IZ$&hةppN29_H|WᨭuK滐t-;*_9oF9`z}\7YC6-ZEFh, 8=sgM"}TP|$VoP16>b>a8>Jgnzuו-O?'}w omkB\Kys$ܜ }A9>kq|Z_9@iIi]De8OgXYt#)9yמ+yKRrm#Ӽ+}6%,PǸ$pBYbUd.d1<^,GY$h#&A`]09瞘?nE#@;^IwVXN;FqN˒iKVP%q@9@MwSQŹ$xgO{kyܘA.r3ͷ!F{⇈U "9H $B7-.Qa\˞x;>qEiI,I+R S87-~_/eb^RH@L[zm08'4(泚$Sps ϡVsb!, 1F1oN*厓$k2ىHZ=1^3vd~|"Smv ~XyͬGQUlFO> sQjjzd3TygsQ|ʯ#4u՞qh,"yR5J9,F@8<yوZmnn#^z*,@!kʔ9V|?{KJH,tN~s#W֞ d<> #On-{]vwFC9$>g=vouH5В ĸ\>bF[3\9%̞~vʓr]շյ|nHu\11|kgAe/iAs,Ց h~& =ɍ\ O[ x;A8P͒N =}1NmŽ:oF%f;[ j2أAy&xRGq˜nwyP]Z e*w!t8P88#ǨRi_-K-#篦kmBW%IUC͌s~UAk%o{ۧ55uτuXa pV,v^2I8#$1u=ʰcRNpAsC"z&>iYDR1GQg^ O¶[tbQF18 5mϺvgBe``".#Is(Ԝ󰃎8j<1{HkiJ NH.kk}v GKP6a_m\Wx2)n4/\* R +˃0PtVu%e jqI 03gp;Hj/Es}w鈚rmdm8Ac4 +MDoe!|O-8zٓǑiF fo,G4j͓8Oa޹RWoNwc MԠѭt,,v2Hw~I uXo{yl$;>$MӖiKwcnIE6N6 sD+t ;]Sg,RiŰgWfBۂIlw|S,Y9s7=sDIHncw5ݖF1q^$G~4{jnǨ zOݥ;=.)<,pIv99?N }!]3YiK7-` xh׈|7}c>w&Vȡu%~#       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~" ;^Ѩ76^AzA Z+L)$zI <`W-JiC_A~ q{bω#^IH"w%͂0;2;xSiC]1Z7C,i"G(KJȪȶ=p>W+;O6YbDK)yTr2'ӦkСgkhE\ č49{ W)S_{oȅVȟ!emol-8sҦoK 6*<8))}fno IR"@G^3r@sڍEm:mA,A?6NSF-$b{ҮlͣATD8H'$Z"OKN{i`KUT ={dym5/ =p]= `7 cnRxby?շ SMM+*I0N*ʥRVvZ/M xjxSyUpc  {>!Yʷda9`IOS˝T/SP7,r;q\_XӬnl/';]izi-bֻmwE^ݻo,I2w>su?7j YD+RYdu|R}[ :ư>ͥ3+!Xr<G wm4ؿ='ƚ+0YzprN:S;){1E|q?ºmRH\ȑcF;  :ZΥ[Rq-אN<qIj4'*k°jڄ2;0?vm[Mien `O=yrkO귳6&04= ׃GM{HեҵWx(@݀X:|ŽN7s|^w3zkN]4 [IxZ`w1$s Ɗu^M2gC&{Y2xnr+|'LY_U{>LL*H >^ǡӾ( `=%0f`"e=0y$v.Ptd\xk{ tHsc85⟊e=E/&601A)MCNw7za׀ 0q|yًl6qAF+ܠ=#3ƭ(Z_,#u|;uj>>Z\܈mlP͸!^ LaT9b~l?ƾ+|Yi- ٓ}8 \M}ywt,#jRQ;;~_{Cv^gz$-=B`O9bJ8p+{b6 0Q ĐQ|YjzRa鲣'(!' _=jN%{GLʡCqϹF׾jKn@-l52=KHf1vbOd?fΜ?0 c;ަ۞w- <^IJU{%ڋ# )'*;7y2[yi|UйFs)ko wv`'%y8Yc~~Y@()?6rssq,;h~iK$^Jl^]fY yhc`.G%GN%|~Bl4La[Ļ̈0A:l$t>5_0@Pޡ(9?9-o[Rm>ImNO{12)p'̙$#'zsxj b u-̦my-b1|GϫCi >AjTüdz¸U s-Eܒ#lyܯUg(<[|Ĥ|ɼ^'=jW_b{8dG9wfr `О濢6h4vFDGbie䀿8enK(/, umvms|quՊ]4 +KJ 0I eH9+/wiewcSzF=sSӒP 秧v:<>$I$.O|2q]_ z#Z4/UHp6BrmAlgd,OlK1$q$m2swp%۝ Tp$WkP[[껽_CT,dޝ^Ȣ6AwEÙ ! #}o+nۭZ)ؕ8'k¼uXsY uR2Uj5-gRllF*d18>dO$F3^ O𦉧.q77-) _O#+ÿ"4mh\5eNU`1䞀dEz^}2 %Cu1' }@ ]JqVzi]}6fe4xRK{1m$I!'$tr%>08 X,hWBf)sn[7m=w_XEn hx-8#NdvXk7k5N2W z=xivRiQutI+ %$6`I5+͗Zɀe;eQqV9>ְ )j3Fg`#v  d[85' _I}Yj9B&oMyuI.&&`Ap28G׆?s@ŧ彿 n.AAxOKOh-fs3Hx*ŌV)!X³GO˜1=G1ѭnO-k]"F, { WRFw$=3F1qK,+9$ӰA^KjgM1"i7Y30<2.kfkW;\<ݒ{`8CmZlwW~.n]BH3>ruc8u'k +}Z jNeV{h>˩Yp?0iꚭG R6W@rA$Hb_?Wv7/iݴ<媄cF:c׏J!>wwf2NW@?xX#KHAsInH -Lsֺz7S EJ$8ƥ5u4VgҞflZ bsgC^s A5塉Y$ f ;r2p>SO Fj F~`xbcq1<Ϸ1Y6d,mlכFfc*ivcJjO =|Kv}7 ^j>P$Q24,HaH$+7>0mBÃIX\ `=r1#@i~%.du[9e$*?Z{7LMX DD4%p )sNв?>.5d\ݤ$Frecy'vWK/,30]1C8geJ|%$:9RJ5]KSk +G6IU}Ek;hz}u?:ml፴YV+!p̪<|fq% 69;2͌dzdNmدexX.!>SW@28?xO:┾[kdl%p͒c3b]_.?Ǡb|Hy%Fʪ00sڛ/^o ZC4 d 7.~|/q©|[Y`fso98~6Zr!ޖoy'sOs[z}}6'Po\fLաtD*6 t N^Leخl,gSy=3~C/xOcwJR/?e ڭip<w$g+ؑX0O+,gE NX6pϓ03w;1\j@G8!b| db2(\NS=!("l/МzcSKOW:o ОTU_AQ81/ÛmFDw2&mw%{w |Ѐ=k f1suw:<3|ixWLj淦^J dN+{zOϯ6џ W/p/"fUyc.Pask 3PmNрV[pe7@9IDo׍lm#G54<)smcij jG<pN0䔶:&y&sXnPŖ%@L0F9__Ьln 1wnIFyJ|/>궖g'& >`T:`qϢ_zq#}mbOsNVMM4I~#vzj?41&HKuD<ےN9f AbFN9c*+]oQMVhM?q\H$durSj}żȪh d sW%RbTF%ݸvU“% +9"e¹|]*+ m"+:?3I9c|y>)1ٗ! lc*30k|i-֥}a:#(cy8EEvYhvvcP@#>M{2o_>[ӭ Ea#B5X.Tq889 x-:s C 1`;GSzqgUKUӭ닛v9a+ݸ_Zox۰eq2[Dcep2ַsydzkkߦqj3ܾbTFG(y=O9]'ZKf0G9v__YC:]TXP9<]eEv-핌|PF#<\\.ש*4y̚Q,Q@]֗Keݴ-+ p$IL@iVo $HRGnPT8;Fހr7 |3 wǀcm#ƍ*lvTdT]781v9b`׵#̳(XI ) @99f'oT_-rn\g 0.e_-nޤm t H$i g-9aƭiG:*IF% 6Ijrh^w mHpl d/|'|WymmHjn Nˌgo'pqj+UPrq۲>Gg/֫ۥB7bۃ*}yMZ=2H]mfd0U*8^I{_~jQ[ +kI#1<^cq9bF6'9>[ͯ㷒{-yQorI ܂3xǽx%n}t?n)S¿?Z.'在 Aǰۜm᳜WcY񧆴X.zA)J#bTg$G^0p2H:n~/mD_;? $:IlW#HrIrOy<h-bPKܺaPc ݖSFGQ?j6i7G#(O4$ y'SrvT^FJAcu_=':]NX{xZ6L)O]=_5[iDžc$J:=[8'|Ǧh:7̓$ X9;x>lt5֚K\|b!8ǾsW4朕Imo/Bo%'xZӢHXݮL<&S pĐ3\,Y4"WHn08?4+v짻bxF9(ۀp8M_Zv_q?,'g93>nPkWlf֋qoGZ ["`~UAIWik_xjOV0ɹ$_~>_InnMMY@i89;Z\lewfRN< k֧֣X8C \eI }JԜjx]`,!HRP/ˀpI֯ltzXقE{ pJ_p@Qz, uOO;7.VeVa8 5nqrzv3^wt;ʗ:D"l#BF y\ 8⫍?HlQ,i,V`) s y^Mtrx/0_e%N8عz5k0> z-b+ZA ^s{Tmֽ~H bYHM:ch` $GA1[_LӓLt ȱ)(\.cr3|O4{Bk0Z Vۂ:7 Y~%u?iXit_!\ܧGLᗰkF.%>e]nbϴp I$'5W^<ѭx7Eh82N38k^|?4_乚 D u$s{ xյԭ5 %F,x$NOZ\7].i'2_9fDZZ, Kb6 W ' Q}6[h- E$ |AnX;sZU⃌$r=Gl[ Ȧ(D) ørF2݀"TߙwůMAeUø2308QH= g=߂0ܬ\E@?B0?Я,*W┙c ac ^3I!ڶPԂ泜h+o^,bKM$h9OUoӯJ/W r|B(,)RL`KՌWo$9c);ak?VQT4]I8R3' ts)њz~z_{=<:fOkWr1W%ר$1^l!]FtPHsxn}kū+oq{w֒;{VӦe{K_lBd #7@<@N/ĝV6y|ˆp2wc=ӿZ/Zf6N<$gh8 ׮[٣ZD֡lk^V .s(rOw5t"]y NV.yUpKp=rkÚ/Y!?('\?{9=r3^VW̶ŷ( c9.8TlӵU}z%j=CNImxǝ qq \8]\ךN %rU\={dYkJ]j3q"ZNKz澴w(ntѭp#{'NqFO~srb#+o;mC^o&g fk=p3枿.2[#|^:vQ,Yrq GN}ƭcx]md*KfMwgr~'͇~#޴A+DD* `[o@Fq׿&+s/甕S_Ý eh(uQ<ʸ,vIe'2Ƿ+|*[TnrmoTp2H<rsO(a-؍@2`cۂB3*?qY-Ο-w]N'?)ldy:ۜҾ޿Sו?Q p^Z䵉d1 9'>],+ $JO`PrGF^jYA}o̜yFQ;@ǷB<kвmw.ܬ@ 0 rOTZR߷hwԒ3:o?)U+u`y1d`#B:=*)VW:*Sn.:x˫2avԀo5/>P\K"xI3pq; ]Gդ|,fv2`2@?B;W뺯 k;K4-pO9n8A>z_o;YS|+m6[ZxJW-'cv`*pO=\]xU|Md%D1Zi rz9_6/xı$q 9*gq _O4[.o +|:vzk_~]?*6Z_k}8$΄+sOc~mcZiX.Ycmۗ,S^5io  Ir߼gr3 n3קxAZݔ&ft23Wp# vj}z^lJ)Rǂ)_|;Mmcgi!,Oþ00;9ۚ.Ҧ6MipjXWvo0(fο7y ` Vޣq7b[ k`eXu$ H$S4CKRiZ2\!9 *79zXNknhyVkx @MTҶ԰r3.@q׮5̶)90ϧ%t F9$< o;Fs8yjqt67cZXLS=e9`~n@XoZpci0i Sӭq >#vSs}< ˇi$?{|$WK6O%QO= dܲ.rz)dG͎NSO-8nW{_#ANum\5"i啣c3aY  1)Gqː_8^!MsV[Y̘P~u;GXڮkX&Ze4APU1Ǘc<'RT8et_~1s-F dXEو¶X$cvH@$Ԛk+;K(V=AnuFHv93]o.gIr6l06>B?@T|I iqpdf r:-a_j;?]vWjnc>#6FI)14 T|ۉ$`1NV58b @&_Ŀ~:b2Ȋ6 6:ڹ/Kϊ~ځ쥑19,vg }sBU&QV}5~)6֖}wi¾möV7 T`ǧC\|L洵 ԋ1i" anNM"Wi N\'i @?{|>˹,/i-cy6mAn-QXI)@$u#'I8 n="/ DaOK`@Nqr:5ME'[Xe))%>frXc AoOy:];ܙ]yK{]]b?t) ~_Z-GRc[6# G^*>Z\cshHg?hN <_ӵ_)eElQznj[$o_WEh5*አ 89^ |1uM:Tɉt۠Ì9=3_WxOǛ#`A3|u-Q&Tp~9-INpAr^*(HӭtJ2M7 398<9i ?̑^6eӦG !*ÝqVYl|/wqEyȵe(rW0p=+ʴSw>85{6$cU' Z|_W"w쭧obaC ag#޺χϊ=SHl6M~|k)Ns$Dƥ$)d^a8w&jXiZcGr?wp.Hh@=Y'g-jחƺgXF &ko˿ظq%&sgl!X٢S= }F޼6oo2\#B-ęNCv6vῈm5]CgH#5ٳ;iKBZ#%[g@8ĚŤoo-vKN+q:'g7ڥO(8Ǒ\%v񌫣/&XLy2{נPO9Gj6M=VH_9F8go^hKqja;Qi;-Wצ}ks+ޟskIErGv$xqy>\i9l1+$*S2yHW_~1Xt] OGTE"'9w;1l]/eei湹>ۡ?嶞C-ޱais[5+ɱ1AN95j5F"CedH`A8`9ǩ,HGm{Lj3)Z';TxU9o^[E}=īg%>A x2jdMFv~zm5Z议hwD=6=Xx⟁7ZNz:5΍sqqq,ߓ0@oE\\L~TB"D _rOϯP]SS.giޣXdrTm >iBn:_֡t6?; W!f;aI-qEt@P6bGI$1_Y~> yl!̱0Yr:])!yTM9$3|wXw]O]΅YzO]xI[NuOW:m}G1ieBxtv=+οfWO5Az%BEPOXאy ŬP^$E34.1=`:gKF4_܂0;H$eXG8ٜRs$ &3o jk;|>/ 1]G cThi˧E.oڌ$9W'h彺w|Pnn`?姗2@ } Q\֚E*]2?>I$e$Ii~;]i_g3-%岏1 pIB5{Ouvq2-d0zgھFλZC);r1%@.]χEK%‰#1$!cIb.uv^UED%Q(UiPǐ: x6w2[܋'aST鑜ネo կ5uaIv#=1 χMesjmq9I#8O~x5Μ0VNzG4rm{_3_RUk N&b#I${n?;H[z0-4X&Hb2rÏ%6'ܼS,!c "f9mmK}<\vdGR=262n-[}Z}o2"w>n?f}:Uzv8ϛ$+a0Azu`Oz06љI1<['ۑ]zzJ[IgPrD~1KƗڞ#ZO$(Xʳ㐠9Qp_CGk}kŁ/]8f XA Is?J_vk}k[{GE0HKJ 2r8>'_ [Ϭi\ZN1=P0NѴ3Gm6n[T|()񃃓 a%.oRVGcAį]>_3d1Zߌu?i6'eͰ WqE>|16A zGk-z__mF;{kQ?!3l^}m?"ibM:0BB9`:'~|TRGy!TmR:Ǒ=r_~*֍v$2\Z$k<|rH<Ta뚎h>ġ&FDn2 A9W񖱫j1ϸHVi"i VpI8Hu/B-R2FυmUN(YG_σ|Kt?TK$24#T jy>g'Ѱ,Wym:CMRٞX)'8 φj%:bj>/l΢WA|{}7.@8B@$n\22f_^Xʃ2A^w_AǮhM< daKG[hFу^ZOk[=Է9E߳ZK"Xw 6UTt{GUHbQ9!3;_EUj{@T*zm9<\υu_7鳼mwV圩$PA{ާ= OQpמk״Noj&x&8*px;z(Etgo uel (-sx7M:wp X`G|/qoKM//'Y~`}(͵z!y[gB/hM۩ h˸9 kM_iR5>Oh?#:sGz4{NځUXZ7A$88^H5m֚ur-o{R\HU+qI`#9$VYb)ET@r˂W.G8e5 HLUw/4 !r!FyuFfXa̫$o|cq%y|+O5U,hi߲w<&ɮY-g/%r9^ K]*=KڌwV(ZJdu M{rAGA]om Nnq|"aW8u;Hv2<ٳR䃴's־Wzyy!NZuiҢ,簹I^ݔ`63I/~BG4X UznXxO!mV4\P6@ll{ѽo SJާ^q Ƭ((&$rHg\6)i¬@pwbNqg8ԴTxdoZ7ӌc8px~iz[Z^}iI p1iߌ/Ix#HwOĪ.YHI IobsHn#mO0LB9t:7)'mݨ$_=ٯu?Žwch@Q38w.fyyau^CtEDP=:qC, z/%pqە8=q ^ܾfK61_@_/R+iߟm-vz]Er}ORV}6_]Gn|xNb8=y#ZzY8yikvnz&|EW n-mp%2P9a=Ol|xoj1Ta pFO :4Skt̘S>$iw:laMA]?iU`[rH`zz|Yz%ZɫCY[n玣=ʎ=G]x'FDP"m(9 U~SqgΥuy3ܷ9*8P85}:~/rIݲ,8ll5M1:B!ǘ9?'#0ZPMĖ yLNI=An6v.`FhUK>Q?trMe<$%I?x38^ b@g[}*y]o? !>r5n<}~Y=HlLdtQ;0,g9Fk%R?23 Nr8}; {mA6J;+1 7H >Z/`ti4Rs! q$\ 3JoemӷͦxγhDM02 ;Lbq+F[]ͬ07'ͳ$ =pGNH9/+׼75=v0׌ )ݝ$wF3ko?١@A8?LqVG{Wׄ4$uɗ̸mT0c^;A[U@'9=rs{?k#]H5]fhwF`@80O +8mgt^Cpw 벞4e[DsOc }PO( ]d·#iFX"V['ɴ! `Nzg+<%&lrmxR~lz;<:%j ̎7lRx(pAv;jz%LJ,4,t$cd;:gi5b[X#߿C]?`-^^I5ݯ:ǽgW# +],t֐glQr) Y[<\Utՙ)٫qmtQI_:ARYv$Evn '潾^\%f)`u8E6W^ j|,ooj7IG,9nӞw? hVŖo|aFsY1'l` m.=mFW1AE[*YFo ִ+bx >RP@>} -ZYB`(7;O =+ubXp )og|m. sJrG;X\?|n^{ MZ-FIgpXW{,w7kmP{A N 2c+/ 5 d(8Ne(tUVO˷·}Am3_X.셧0Tc9f=G?"mjM/5)|NHs2KVǎo|GC#U)%GU Ćdjρ_X׾m ŵmF^H@ A#$pypz~W;yrk^s|m~MË}i{8)8;uu?ۖ:ΣakzvÄ` ~CEfĚ-Hf#' s鞼δw^'ؼVa=0Q)F 8|9 Q"wvfh8sܣ*9c'J1zmyfNR]oJkϛk~;[* ,xt7g-cIm3L 5'P6 =ٯ$/+[Ko9$eC1w|* TvxVr=eU iv66;B 4c8_]Lf.˥I^,'.>cpSu#oƙԭo-1Z6|тwONy M+Y4IXs7^co:.X!N$h2I0%eUn'*T4T^u[g=ch^ռ_]*t-b̙PI1ksOhK~Pi#rG&Nͤ01.3s:xgB2C[$I,p[hPܗ8x/F(ӦVgyDl08# dot߷!%tF>0GMյЮV..҃g`Tc@s<k)7Z1[<V<5kjDWiڥ qQv۵Fq˶Kg=|^v|Wj%I'rNM|åxuM,s)+d! yώ:mrD/W31&ʐ;r̼|۾S+Pv&waN{_@G ]TK )w|cm7EH,cidR5He-2Ka#|Sq YŽ#0qd`JK6ï=r.L]!X|\ ęFnnUujt8mM| V72ʡRS߇/=iyv62Zޤ0]3Ux#@9júZuiӳSKy-¼7/ *o>{rM7M( -'#)N5>/e躕q<` !0sQK?nI- IPON[T<^}bu l[_EJJ FH tSF//꿭R/u/[;&fHH9ێ_݄,%y>V9 :s9Pgwj6N#4uw/UN{8¯ x4R 6F0FwU`9MX^{dWQUs<<[9灜c&|?6T_7?ign|XFq8u|LDzz櫧Y YͺFP~NFp3GBGC¼U[ֵ:ͨ.x\ s\c{﷯Klw&S;`4 w# a}.K}h˟Q+8@9`,c_1; l4|³Jsԍ ߃b%YNL,ŵ<4?B8{9/׍ʹJ$B~Qn5-[N͕1.eJaPpK1Wz..^g VȉvX FAS]͟BZZРћQ/VEx7)bch9pז]_v.-7աM.i&O*6*[B(BRR7&L2q墰cT ʖ`xA=? VhVyh\*sq ]FgTկm{+eTb6_<\[>pҧϸ ;P݇]8y :E%jk0Y6 ʍ zWfYvN<.: 4<7 z//ͷw?wI9[|=CRO{y\7A,;@9y#_x᧼2_|eUO HH~OjwO:kl7<GItZ֗aiFKHaXZ̬ ğ{? z/*]=xᮗ=߈t+8ѭaRdzj=5pzN^#aƻw%6,nbKxFSh 7s2 huU,d%4>Y6r|OPF2x0!Z{8ͫ~[Z^fe%͢gҞ(:',d[^_-@ݏCy xLq{F$V L}<Fz?Ljo<6ڥNt1Fpr"fa3@Ůi~\^qr[$sNO=خW} ~z'!g# J1_ғ({Q]<ۥKO*KbEkK-cvrWv(t43"Al$tu/ʛO9=/VCs:~e5&~k/䂤:qC5{Cn>s6w` nk]bP4띋%ʎ$v;qO[wi?Yjjd0Oz}P7Οu+Pϐ6h؎>{.|Lc-$y%E9#̓gW/46W7kg.>`˃Emxv?_ ',Kimmt}#KI v) ~2kGx Z-iVcH$.±8`nxCvC|)qYn.As>ΪyK+F2Nx$sMyi{_=s¿f P^č?$l+`|qzU>%TдHvCʄ<_o n=FFqTivfx>ai/X~vbadu 'TW{Pd.%G+Jc`1T ZZnIJnz:>JuT/*_Yj--HR^Wz!fX.w |’GQӡ'έZ''d-*TRj̋]ǿ,qMoy n(Wy<~|SI]ߴ pmd.CFmY;*@kK~$Ax!@e^g$8@sXVm:TO|jR<"*(N[8ޮTa[oS,}k{\oF #8#c1$t$2x׈ [7!RTyaX. g\sKS| nYnS\DOU|.O. uYmDyP Hm`SMR_~}=.Ml[S^?v/;Owfi ddp@F񧏵F B m0?@(1$/?7˃Kc*EH(8cA!2`8-Mzg)$RDl#qBk,kI5$[6ZpI{V);jI60eV=I^#5d<nL(m!{pC8nrH 9 כkZu.;È٧! .zr17q^CAE?)bwH9 v Dp/>oLa$էҬs-c,ݐ[v6d`džT_1Bi.0ɉ !qWOe݂#t g;сsR˧3y6 qawr~Nz/%#xsK%?:\ FN\ 6HXS4ǪApB7n 麹ZCeʮҡ2$_%#,e;O?xv_k:;5Ā>T abOFۂv5iAtG}$thMuearשD3AQh.N?vIYE+CK10Fº4DBbfV10%XDm7ʪT` WML-(yܫ T*Nޘ`"8k{+ }q~R |B|# 6!uRo/-B!# qߧmexSPK x=>iuO^oϽR|km~GGo ~_IzZ[ Q$dpH3^5=OPLic2*xPT p#?ɩX /&FAOHX؞Gp o8RӼgjP.̘I|rp\9$O#:ܼ.=ĿGtL43.$n3D`5_|aMr텼0!T?xd%I7غ+E7_@:F˻-2AOfZIn5=Z-aFv}Mp0;oHꤔ2Z_s ^0xr)E90 [,xl-/¾ׯC]v4UPH9 ÷ Ҟ ˯OisY?ږ –9QrF:s^/3|JO(uk]`XpG +=J.sRZ]~^۳QNM[L];]?".BfPO_Kc"O:$Ery\^[K49{I'*71qlhl$-$9N@89;KW뮿woSH^߉Z?C"M2!̀+}f<@5^='?[LɨY[ud tmG=:V}zQ#k(ݲs <=_KҁITO @q%.W鵌ݵc~i%!fU!APG|2s|;tEZGEF(A䍠^%o uMb1dg |;^|ĺ 6QO Qɐ]@8%(6=G;GKk[K+ve m8[pp>E#ߴNy sV 3i1 Ir1^?<)ᗶ=*2e0#3dV xoT>a<7!Tds&(9}^Qvb-,."` (XJAk+]¦,`|pax+ۧ젎1UهB3FrFORK{Ÿ~ëh@H`6OM\ݴ{mOSt㥮Ϛ1=k@ӚY~T ``."|M@xI&S-v wds95/Cxo1i[LjRq#pP:G>'_$q3|<Ư_ ϧE$2D\1\89pN7d"^NKvrFGR03^+?lxJVEpMo|7 'GGFOsY+lfڻrlc9y)߇~ydIUƕKi۬( "(p6s\FGt/kL(U 'A䑏\9ˑkS;H~[y*p7rއ18^zL62>-$(RIP3tmtt?~+h6ii̠Ghm/  F~at9>1H|p 1<7ii2ޫHm#CC 8)ڹ_1kB  sq-Ȅ;yI1xP>qpEj4ז׮N\|5O^RVh]6mrp#Rqdx e~Xb70nq ՝E5V+KmRNb6F0sE#5j@9*͹sGqFwt>-4AyES9eY#/9=FOcQo'l}1W-!6iXM m$T1޹/Q6w_~ב93zfc%U#<v$GAcyhu08Ux1 8 y<%[^-M/He%c`_ g'8'57oyscwؑ#q)v `{ץ:{%}½, Gwb |/`3n/igs䔤)pHI;]~а,}ѩ&H6FS0y/  $gӌYGY6o{Co^g߂zx <Aٴ\p$׀uQUԙHa mu54ͫJ$2Y< uۀE}uo}뵒sտ/CǧpT&SYށsK0#1Gmtْ0?/d =SFgN{)fspvܣdmU_Q{Q1osHcxķqs%R+&2X#o Q[--GZjrDV;(x>CfMT z$<3KQ[\*# o!౩xݛfh>` :`30*v\i^-ӧ'04xNFQФk J$e[3\zT>E{G 'a9 `1#r0suAqQු48aJoM9~ lmdC`:?6 쌢ӊ׷yvӹ3: 2[9XyEg=Ts:6:lƲbKi&i PI.zg\Űb 4i )ÓqӂV_>Fb:`0 { qF8҄d_ֿ.5Mɯ_:msCKY.-,nhsk3Śn)u_O<O8/NYj0J^[rc#3{(:sɮéZ'܈<+Fy| jA_Ӽ1>[Ovꠉc~B2XsG渔[?}_J-;]#s'8k6hw)u"q#a\q猏n< cIcku%,d{ `g;@hSk9V=@Q 4FIqJj X>}^+sa/g>kip vx qx}mmbn߄|8Qk'x;Y.zþ{ ``Ҕ/*m} ыZ@66 7$V'8ũN3ͤ::1~>'%χ.uYYk& !"w⎥ݬWASi%~$ PyUq5&+;-5X˝  IwXuKf4-d0'=c(181Hƭ)&[/mwM,D&wQOj uCKCYyOFԬdlk(Ű5fیۂzצ\xPmŎڶ~5ji` TnSڸ/ ŗ6Z^r@ v Y{u3W5Ag |]2jZeƓo۷HC <85^n<)C4+,%Kb\32 _iu-_O[K (I\`';qPIs/h;쭶>X`b19t&ޚwVWܖ.qͺ,2&՗$*1ۃO=H#x- +c'rS^v+Qv⛭FIw(Ψ@p|i Gkkm6cswtrH8]nV[jգA,kñi 9\rH8ǯv~5=p;>_~^spqQsHm&lBTnK=>x= lky"pKxR8,ǒ#kg -5o]X#ӡHQp@aG!Fdž>|.\g^)3OR&cGB{u\i^VS;Wpa~nB3p+ޥQSp}r[##'zVL( tٜp00\X?4}[}3Jr3|c(]|B*xįRα^[Ԉ;iN:v#8jwдsdLaF3NRyJTLja> F1> '4:#n_/$ uXj pN?|ZOl, 6dwgÿhiE{1@z>R+i?^N$kT0ݙc# 1+&wW.Z:75V0]cǻDl rg8#=ďh<}#Ow<W$Nv8?e+sx>"J2n|hU1.9p}@9xsr('쭧ceF-^Sq,vx7rYK|W.RyOgcp\<>,' !ho$` ;@pRQ3~lG߂bE/^@O1]xa\*u`٨α|#:+Z+0=9@~XW($6ơJE}0@\ 2:ti/OASg'T22;u<2'Vf1#ߎ dj:h&ꮿgĚɟM])As\ Sy=+oψv[5ŴNVH O$xcOs\d<=#hhZk( w%G^#9"4Z֒'˰0l ssjm?;_ڬ¥|ϣ~xW^[ԒHmR7]@ow98?gK\ȶ!T8 t־ e ^7N> GS{b'N?QmhM8,x ֬MSwvt۽- WW qfG 98q/>^x#2kzX{Re,,\8-uzށojs6f>]ä;0 w`{F,0 *q A^TͶ~~LV3vo?c4[[]2dhx~U!l9@O##Oტݗ̒6Le3|&m5lF "7=ww5Eͤ{i8ڌ5V[tb1\O5oi?e Rmn8$5d z[7~ ?[ޫ_#8ث#es_,ɭAkv-a'qrkSYٵxZy6 %7gdM^bӼ'hV,[9b.0x"3ww?S][=Tgu-4.EipM#O8'+ͼG_lt .+Sku(dY<*3y<=UZX&d#A@?~(|K|Ss>-֯nT, q+?춿n #[ԓ]~cpUw'` ps4n7//$j =Yx 5ͧ״+I%7Ui‚ ?7?4 CX䵸|ҥG `dnvwۨ%w{d2R]g?^l7$oa-.`.~}pz韶twmJs[#O GQom_cxsD]B[:h$qR3\gG/8澧6Ww6ڈYg%I} o5'|\yn l'N+/i)ǖJOg7;GVXX$~_մ&\Ư~hlͤBGmŃ#Ztkkk7KG0DqʧɞpO|,$[K'lW,џ%ȯ>Zk0>i+ip* UD'O=W=4ᓄ4>65vO/No%nr1XJ,[brg.թ^\gqxozaˮ) l<@v`'Uko7KmRy apI8)/'`RLQ(A<i aGoa'gP,Fs]O}*Z6;I <8ݞq8-[zܮYͻt㟆ŭN[VJ rK9*N w`NN@{10585`X,M!q}2A9<.\jwuv%ϱTnRPN1d*jzOm=a,^&RYH-"$@*JZk\V^/c';"PKKIp0mR:cۜ~6$t-;QgGI#*xdq=^k nK8n$E."b8fR @62XvMA3_, {-=#PfP1f%wCpWtXԵ hȇU'̏ TryN1"If Dn$u^=ەaA8\սOAr XVٮeI~̷-U0I<1T*Vק[z9(:[t:ڽm$*f 808 ;Mdѐ',Kers]ׅk I#{ZNb =3ۥwoal-,UWduqx}n]9$^WYbqiDž]'D7;#ۧ0Lӿt䷱60Bee$<>80^Vq-[gvaOAN3ugRsϠsߟ*Z[Oy.rkz滔r|_i.]Alr#G|w:QmWO<Z*9PX}xxwT"Xd 2!w6ӐqUMB]6m?O}[*s229z󃇪jnif0A!A<;8sWz4gHJHy*~R1:Ȫ6jSjHaq9OvEQN;u[A4n;T%| H0@^qѧX5PY%f#p8 NA9۠/c+54FYdMd]I=xG?E57~7:Sn`:@e]ßujVvk~V~ݎTv٣-L)׬7Z/8Fs$$|swg~>.k]H26 yN;x z]]|z|[L7SX18\ 1\o}~7~͢W]b*hyKiU' rI峎Wo\˭gVTgi&s ۦo~3J >fpY2>9=O$L_OK[;d"`_Z|%|>TYol˶r6Iq8?Br\Ѷzt1F>mh8$Ü8}R{3 :p©ccx'7\YH$x cN&: "|H8 8pq޷t }ЖT@]D؁qZ!1fIΩV:X-QwrI%17 |?f펡L@aP?t>t_ŵ;i nqPm9jdi|a/葐)/`$pzt/#X3D?Cn$Z? YE]˖?3g9s?]\Ez%楪i`/ۢ]~Qs8n޾sx궓E)"lXnܹC#df[ŗI&hAI㓑뜁gA^˵F/CEl[h5iJ,0nsAV&x>/J2-pU1x29 Y_ ~MBKBo90I pռSM|/=MY!o2 Ī l5̟~{JyqkE~z7HIsd=xr+7TϦƶεqi[be@vCqCM&Q5[' a]H n۴x*x.񿆬!]Uf ť2|s)vF7Hp{hؾH74Fb{Oh `z;c>`1kċio>]WѤFc _JWֿN5 Xc&A'e|/pZ \4)3rs5i4.˕ejߴeu[3\ޡ j+J˸@ltj|HYıoE!2QN1|ouipguS*D229BgYxÞ%tGm3 W SG~+~ϑ74ˡ˻=X1YJo[VcSp}cZݴ\^_vѮ\ ro `[$:p01_Mx {SBĪdc V5_ֻt_g_~ &m = $b\ʤeq4;M/7-4!hou '6Fqջv#<cnMmxZ++ p:°<z֖w7Z+XXefYPnިrsA?}/\wkCݽlmUEk)3FGsy!]yhѲ*y;KHr u's^CF<ƶJrX9$GaKt}"'{yC*ʒ.ӵr?N%wO.+/?C.|kya9-<Ս'\ե?htYq-4Y'%vq:MkHqEu{$0}#0BO]nVٽzP5> m^h0c+zgGy"BUVLg<Ӏ_em{bLnZ42d%8ul$l*B\tz/[->g4k ;5o9ݒ4x~H m]i&ieiwۦ+ $q1Ϡ{6A/R42Dav2O9[:-MKtSf)tEq9{YEvo%B+`J]vGg1xS\WFHqdBIb2rv^6v&Z1bG^kLJZ{g 90>@!FگA*:#%F;k]LnE7{tY-,SuŒ ;wgdۜ9>˧ܛt/wonV^ V*8w'=Nm'50fM r-Æ#!p}@|=6:eň0xvY;۹t{ܶ_. K9teHo%<[; r.;8xc6ZH@-DJ)$xfywVDž1 C׌xNM$_[V .H\>1TPsw;=-O 6˫"Rg -6 X,٣x_Pk 5K+a 6dg񷄼)}zZ:Ɯ]AsF.B $SF5'w :+(4p$bg`/O,,oO?6:N7ݟ-_G5j >#^L$O#7g'^AyqH11`fS} cdvZſxwQo58 vQ#DXnʾAp}~cGϾ=ӵkz՝铺79 Oe%*󼬔uO]ۯ=Fj_?Vi<׷iiV |prA'kD>xKx4]nQ{q*+|nFv/q^/}KXB̏-Lhw@ ]ݱH8<)la/ ?0ܒy<]r rMwt"s^e㟈>=vj\?c nJls$u q|о+|.|G} k!N -8a)kz>yns*p1p獸?oC!NIkϵc- 䁊w?9l՝OF ,N[-oסX|SD4Kk[&0h/[g$)v/Om-?N}Ud +vzAkn.ܬ9svc CivZted E3a@f;gVҲ?*vfak˨o-d_8ɴmYݸ$``cxVIhZ+_ۢ1p>F@_Cg[[XrnRY)ԑ2v+aG ޅo-fy%P$r2KzFVo}#hR\3UjU[}6 *6Qn0!2sҾo3 T)ҢK2Xp3 gmS-)!ZQ1`O#5|A' m#+[ۨ?7Xgf(wkn9\_o>-q(Rկ\=A 29ڧ-GAo]KC3** $^,ho 7ƊviF3+ۿ㶿?iN=n2}Б':;% v_|=#:r]7Zݮ o&#n< s<(k)U$cZ=_^֯o}pbcy A Jq_]4F0 /'0W?2aN|oft6P3-CH3}G$co]QӤ* 2cO*r8y8QEY8VI T|i'o4gIo5LV, VUdV0됸 y!tW*>;i\So*AӒ=Ln)i~(#ϕSyc(Hlz REec,g# {x7D@;\9ӯz֡r$(&a2aa|{=I#$W#MN2oOz8fw3_,#xl1!ZF s7:N]cy`DVņ[!G9$kym,<%b$g)###_Ee[9o_Z?2aW1!%\o $9+TvozJy^J#Ac{qp}n@ua<};&ǧߢ}dQ\7&6ppr<y~1kP:rW3uA'8lVټK :-;S-:Co !fvH蠞J8=nJ߷6d^FfQy4RVYI" Lc$XdADK<(N;#N1wgyf-2 »Fuc@\9l۸dU+5mN=nIl_K6K?ojzf1'"b#wpv;zAsYK-̛W#w~5 MսĆx/`eI*rxp:^87J:|d`@@U6AӕD-~o"5~\i"HY|2Iwu^Fj&02*Dp~U3r1ԑ};sூ7%kt=6uio#YF7`<+XoxW]57G$0$:IlGJw 8QG࡭.lmQHU\'pzaxkW4MC7:[-VȰc# (%z?4xN;vRH&.&Gr@YuiZ\hpYEMI XP͸ 9Fdy'= nw:tyYLyhTe|x+3 eg1 xaq0{ɍp4YGs"B2Ă20x5^5nlf5p)i`+! n;b6+ȭ*owo?V?|6"]Gῄ<+}#Q7YQq{'b jL@9#rk®+X˙cEc *]7V6mk,QIAS溫o8,2Sorw 0z㑎ZZp߷utVWz]OeѼJUY@sVVq0-DH8nyTE2š4$ mk qQ1>F$_N.⧆|G 6t:]w6nCzNo|UsO1]]jn?!x "'TMo/c GwoN\]}oguH͸dx[ ;F3zuAghJH 7$lz dmǞ~Kh ٜIn,4 Ż {%I `}Пvpv}8RJ ~kh;^di?n$B B (c!r3ȯ@tf&hms#?w/"o^wkztJcoY AB ұ|3⦕shYnlPJ ea.ӌ{){E&䥧_ԙFRz/ԥԖc)*qqxZO|6>JKq2ıJVs]Ґ|<6>k-%he!HjjH?Z bU彻8w9$p :^nF*ͣo*mZN{)fd%gO~^ժα1mDl=K|ﻁ~85m _@< k|w ˬnYt{+jw)^;Qn-ʯ)-WSl5WMQcZeLݜ9bNIR$>F5%$n8qg I<Ag+I/ }gpĤ۵[ rI<d?㺲;M0Z`JA8 W 3&r?sm^k^.-`ueN993^s~|JCeͺ2''u#о0aɫ^/;8l)F\sX^$_{ #Dy ` .1)8?}WQ*3yOra6uҥ֤TхW\r9 י\[⎩.Wyw(i</q}5v%>I WSdeLF9Sc9>ݾ⿈:qjpYDyfb:`pr@9%Gi*z}zlg%-}O6}-YmMA>,cvXś `qϺ6ew5QL1 9f#.>ߘ # n;xHE# TuSU~ƇMV{lYF<hpSkw&%a,5&X8Ąt.OlCY?u"Ecj$[Z/ow3FY*=p9cQ+?^} =:OQGwq2AJ6zS^0,nSXhEgr\Hl*\.O=Ge\ _^r#K#u>cW߅6zcOo2E7=ҺDR Fv9yh7٦vBҗF.G-xV(inBO^8nׂj,̘1j +s}0*}GDẐ,y(A '9+*2}PӞE;ɻ92+ڣ]H?cឪjޯfsysŅW?9Q_,^}zx%@iD5@5:3铊4{inlZ66?keu9(X=]n}S[׽OTE{gM`tI- EX ±s?,c/e2%`'V#=0=y _R1|IkPZi46FbIkuuHɪXiA(!\D*p?=zxh4ӢhRw?o¿ x;HFc*B{dyl`|~ Cgvor==1Z@Ew[I xGNm_Þjsi*Kf)%I9sGS^N*&ݵ۹aq_ӆ?_^4/UڬIr#UqFHs<(xvw|Z {y>l />\+w_kq\ ;Z6 LKqC axƋwi7t.aUbq$9?U)J*vO_OSWUw_Z^^!N|~HgT<5gF5wi+֚L9t᳷wB!XLdV!vO<sgN6;x1Xrw 0\ pA-8Ե+3k 3GIAes@Uhfn\kwo>ܷD HqasUkGik6Mk;䜮n/{{h(Q/iXg9ZH4}&&vH~S*ǵ$2zcמ5syazDye,9)%eI^\bCBmzr:WkdVj2t%%޻Gz!y>B~]@w#"gFLq1ntWS|/ ..089(0={}: ꤪI;uuqQwo9B6-8$yׯ_P} 5^>?Oju/ &4ǗP?.9ǟOjkxPf1O󷜀YrGx;fK_7UM](%#rlcqqMܛ6kqo!'Sr4C񳙭ћ L8 m c<N<~Y^v n1Կ4Nsrk_ +B5mc_My c{`A#dcK񗲘 Ɠ|a+9dpz^iY׶[<7P,[\1׷&kյρ^念eFW6Q79j*#uop<'܍>;e!K/U$*;lsuN\+^\yhIVco'rQz֟.=u/ _0֦S#l1i䶐Av%pH=rL>,<9lmvy[W,ۻ~lW8RgYfn>51DZV$JfsM:m>'.F(K$ {nG[N^ﮞ^E4\ߑ<Mƪ6;U*.K{x+H l|m/)yKYbff!)RWL]H`3|n!cëka֑7oygibXp$}2xVEdRvkc,toUN8\.JJ%Kmmf4v&3pHwI$` eU}ER }f.ʮddm@-|(]j,谵) /2q8NH.[v ϕ%I q $23 7'<<4C!K[Z;F<^M$qw$dhVE(NߕI u>Z[h A` fzχw]i]e/- d> WrFkGmuS,Q%/#nX,`e2Õ,dsO i1]h+l2sI?1Gmd}BûG8,#ݎ2= o<'coad]݉% $^o٢^&Wlg+]s'ݰwR1^}Zѧ)&~[5|ҒF|%LVb2r 0~+Q>)͈AA9@"R{r?}k~>+b+^}D- lH2AI] }*{]:;fA;*vnzzTJ\߷mラ] eb3`E9?6=5~1C}] ^#|P[}p6+ychQMi6ۛ--ϔX,Ű &$?^_ǿ6[I:'9ӝ<+ʭ(G/?u{~Wy!vi>m"ߣX HnFO4EݑASxFr W'<пG8TOKzx[egeKgcxi.\59{8Sܚo-+4KKvEFXz``wxProuXn !PyO͞<>=0:$gP{e7pʥ~P\E,rW9!ʭ04Un FI'9}MoV?MEkKj |v.pO9F}94tb!}d"#S 9G$=ȭo-WrB c{UT%BfEo]^89ITWi{vߦ6bVLms}p0-z $pIWЯ'RM22;[r{,8]̀a89Ў8>,AFm?,k`Q霴I%qu©:L8Gqp) 9AnFzZlq9r6۝ŌL˂nsrxps(5WwgSѥwGmi[|2 ^G|t3PFJ߾C'ym `rAVWp; _dU9|GHgS5)mk{?Vh.|)@X d 1Q=,͒ <l"F0u_R#㨡|B *r1Ӡ' rxrW糱I+_wDotU24 ,j e${4K=U1E vR ָxcEDB`c1 sG^=y5H&h&a԰c@$nNs1]Ƣ}?o;HͩL{R듀Swgm#QkjbU ?.@q7 Iˑ#hI'E2}ZBs ].Tɕ6/]rܾzߏ~"[쬴;ti!vĎ0 ggmd-7׳Vm  aׂq渹(k flqH<zdc<׾PҴtcEQ@`h8$=8 ?_s+#?o_39mAaAN txkÃ-"E<bA>jr @͓ `}~./<'w3r;wz8ժ*:EXd;C9o cȄpr$tsċ oH#'lG*{{q=r{ᅬG8'ozG&[#ߐ}*I_r!D|W,rcë7.ED$harp2z`p<ȮPjfXؐw&J:thqeyAAN P8O>nK1KosGEsQ ~Uzq Wx|UxM aRMGO'Voa|ZW[݊1T. ?nTZٔRNz9 Lpo3OT}sNXARts9.>:2ȉ5$(mu8sIYG H.ݖiw%Rs 硬s", x@e8gNvkx_Cy>0im J"[$L~#|_UY"!1<2r :u$:aO K:IJ{饿VZd-|' @ ?rs8ωEf9u*+km4p"qvOZ鷇a߀If lve 7ɂO<`pێ?i V?>R; T}PGcR@FspqMʔVu XL CG=3B q ECmVGj%yWGF71HXFx'=umoLIc6 Ucׯ^k̯ۚz^}fk8YKc4*yF 1hS . N@$/ףxvU7dO7y /TWk5{_Ej%hpT@ݜ(Qk_[Eq)NO^1#wC_9Q58-\|RV1[kvyg~t>hru]HRff%ab2czkX.h7y ¬v*TAϩ|-mG0Ώ 'mՙ.XWdN1Sf˚1v_+>Uxnu>x} yvN\ B=N>EeDρ ԡyqۅlsV/~'k BD v%GLtq4tϊV ̷̃eDEܓە_%ȵK5]'?Udu/F$`n ]2-K m% AuP #B3X&p^K)>Q#r,>QH<?ĺc4 vNӧIƇs>OV\^Bm*1 >lKb_Oڏ_ ];IcH @Zo~Et]A$ax18law~ :m{8 '=O}mNO]/^6,8v 0F;O\دoHHŐvG$cqqҾ+ 3 r XR[q`/qrӥvKXRm_ס>,~"1BC H^bI88"P 4RI2q~n; x>֕ij T@G,T3So/G. bۖpF;O5:[ۗ]C|dhWZ軺C[K0fcF='_0x5KxGC1F@ \kZsIdX 2y}YB9<a'̞1ӗo0It$Uwm-A=5BQ 9B7= x.i#Rswy=jI^`P3ɰn<8O9=e'_֝?}^¥n<\#F"3t;9:cTt@$yp>Mq;iU!L3gs$MjCHBcCNd g<b#{;iCO˭SҟJ%vwVd Fs1}QyH9l9M8牮\YdgDQ޸- ?C4wvqǿn]|巐 ?SU;p!D ԩ2;334UH*FI9W/ KSqc89߆_/2o,,á8jTF-Jn.i ~ZJ݂>0'#_Fn;rv'n1r>k"U*p0y$ޕ#C j7XOn;ƛ%5Ɍ*痧n JTeP|N0s\洞hCfBevx?1k*ג<$AcA7@!uO $6 F7PGFˌu";Bw?ӟL{ql 89#޳_)b ݌ǘDfW#dL8#8'#a?ix1L Fx qkі_6I5T݀Y@?8\;y!ʺ nø1 ^rˑ(^$60 <Y!"@w_0r9TI\D:@$8dBk3eE@K5H.rH=|Eu3o1YPyp2sp}XkrBQ]9r:sz q1ή?X pI!s鎘XuJWGUf+kEܬ H x=N DnىN<|-HԶ"! ;Glcr9o.ʂz!r9BFsSV%ySs9=j?7(F 0wu3K*gӓrG|fqBMht[ĐS$ =Fp2x14%6X/:skMZ靜OA xS AHМ^Iʶ*zu;F**W{ GusTvep: G;1?ڝw?7ϯ {i]"\YX6 dcD\Ѫ#lxѶ{>'z}NRmon;HdD3?tg߸8ۺ?-wuTCfXF _B>:0@0XRMەm=_]ҾüeBp~fz+gufh5-ϞYL"Fb 1O|Q +34͝B|z2lgpAq=|F@eJV_O5rv,' ݜRǨʱpdcQ랣CoˆOFBK9hG_¿;OB` 'U%WCQDL%^R'kdOF.m/̙<덙kpc'|۸p88t98S#osNH7^:5Z7[:臺s2 Qwi[O3/26V9{g8Vv&indV =#r䞽W9/*ߐHrF`I*:R*PTd'>"'BEd^ZyN_Gڙ"cR[ſ}ͷ%sӊcbyt3>@ g"6mqo"l NqzVxG⮭ia? bβNČ>nӜnt<]7nKuk=J8R<+_| vU.Yeësߣu'#OҤ6bYL u#<#|sjݯ2QS|wmk?ĶIsjk"UdIʎ|̑s\]FV'D ]kzciBӼWDФK;\3!URGXϦk~4yjǘBz^Mz%m_nx}\&3V^,m(lx9 s?i~]y/5xXJ%E;A4j%{yUCn@/_9}k$4 ?26'C3u[\7Z'`K]?NUTq1XqNr2O^0t]." vZ_˱ZOM:,f(.dӀ9A pOQlA2|qaL:yh.# cnq\;xy_vŗhl8#]?h/P/e]9C]*C9nW .~\ 8n0^QI".x( ,ISl@m VUK>#ݐѷq+F>͇U"j5_1kNnz]>OKp4rlb̻H$ -I #9%`:a ?2LknRJ@R\/kF|"ݒc듆1˗EXchY„,,ys%Doeb$-.pepQ1+N.p@e*αߍ͏41PxU*f QZ `dZȑpgs q#&PlF9aAS k%kVvQhԲ2$ɼ/}|#SxWLOe˜H9ݜƠ:D1" 9P em8cӂ8fSEJlkqT<>/TI[]{~7WaZ$/[σ_tx}&Čs1U žsԁP|RFW=9'j/`]~H =9iEjg.:t318ʒcE?6:ǑZ`YMI-^X|iGU94JnڵkƖީx&}RMKS{%%幇 $r˵+ݻ (? 0r7r]'F:v0IH1 'oZ爴mgSb*oqy/]۸u.2sO? ﲊ>wKira#a(%ee {2dd7t toG\\[| n AؤٟMhRڌ )U8p1V&B<fm,"c E!`q}ޘ#顛c|>ݨiPAPEE,lv'Å< M<2E,/Jpѻ" m=s OL3jS5҂ʳŎwT?~ =mv#+j9qQݭ_-oصv9[]MtJ&%RTéqlU2H= ^sOk0WhݕXdzp=|_3IM|ݵ.+$1=gnoǡ$8 /=s#I% v%qq{)fHe`ν85#V7K^sG˖Fz~I+iӞz N zyۯP3JcI,iLc^r01ǧLNI$}mkt[-Wq$4]%pgbGN# m}>ߏ($9f6sp19b!B $ダsz?Xi~`>H(pwozr{\xg4La T gF2~j *$@ǹ'CJ >\x\,9$ϯ=h}-2bmFZ 0VP۴}Ěk+H+0Q:6~c!@  \Tݎ|xxRj*B UcEO-r @IMvO'kyR)2:s' m C >Xe(D2T%rxB9aIHtےI s9aE0k"bHgڬ[ PÂF5]7kod75rTĂ0701ƲΧלFJryEB}]C`A}㻹Zy bBA@$#n##`v^ޯWڲ-*K. TJ'׶GVnKbby.8;Xd䎜yrU v}0 ;qڿ$` &W [v9f8<8 :o{5 &{;fC[˜r#.>UkU垾N'?dZ9BbnHd89ZMBH!!Q6#<HW+?#kp9խp]K9br7|<5lx[3I90?!=wބ׌KӫN̍{# ;h“ pJЎ? HՠXu!2 ;QTEi O2qrǓ..KLqO܎3k.df_ymIϐf_i;X<\& aJ )-|q9Yp%x 'H(4AΓgn,K3oa\isw2yűcq+ӫ)h:`GJNjKgWoC1@5' b7*=8ONUG5˩ϟpXs'*y|3U</ V!Y|,Q8 (9'aA%l]_=2zz_=^knvd/D8~2qȪ+1h2* NA :#N|եOmz %?u|G_Ij4$8a8*NM6X;Ek9c'9?x2 |IoXʒ}FRَrx`Y -vD_JK. m#W=q^t~9Г_(fL?޼bx!_A2sۓU4}H$2! ɻ$ߑ{jl/MFF5y'3 {zw#g<5axPAqW8%H'qxfu]J]~7 R =4[7Nxc9MjV-REmd85C[ޟmfe$p^L`G_.~E2mrgPbUo%}y{i~LFqH72s:eAd<T*+eu1q#M_*- \l|zA'h~,[[eTe A mt9 <]7;oyZph7U?|iL ez{89Q6HS.Gl9澨f<֓DAWf;{s989'P5W 0l=~a=x~{ wVs7x5oFxpaK2#uN)n[&01 Q_s:*?<4|ے w V\fYCdwS#>ZUjQvk9ZT)FQ#`Lp=}?$r*C$!\L>V!6#3gsr @ U]s_W1Ž69@ .^{௯n⏎YK)ff^o2GY^ 3&9Fs=>ص>S"qu[.odY<,vpBnլl]@*?%)+p[hnsfL4#K%,`—$m#w0_[˧Y}cʎO㰭2u|,!U`w8=Ǡ: ^,mRkIe]0?LpsI㋝KV:=6P2H$uu$Ӵ1w2a.vG q2Rvӷj sڞOn$ HwX`zsE[W=w}}שZ\uD9VY'&@$` p07PhLJCL9FH< 8z1OYu$'#0y#?wދH&pc«8'#KyewwkO,,d2ٴ` vsF2))R<<ps1*79._媝GAOx_i}˖;6qy3Iz?Įe6FRCFsEL6D9R@<An=x` 3ɿl9rC.ᷞSFs@D T0q 1t89.Eɫ~<:ik6EIJE9GRPmqGl(O)aܱdw0:#=N;~bm#z##b+UuLIǗ ~\t㏛i?;_{|)%f*` nw^zFr4P  un: @I2 ^`7o%}H86gR"Ls Ѝ8ٞ;O߲٭^ޛh_iѩS 1Œrrۇ5 KJ;>Iq`)l<$wLRydr"p9n8GM˶cQ@Jiq<7~]N]2UR[@+8֘߰v9\py?7CVDNITyvpG# 9qNl:AL(v%9Z=o4yJ"$eu `A.RC5L_p ~t}+F0CɸȠp99,~\Ҵŋy ӎ 9*V?_m_2HG 2J| <2}xY?z s؃O905Z@{.U HLrNN1d99C/ inad"HO p2r=;rb+t*drs Hvn v =ԞNzn.RQ۽ AJZ(i!Bp9*9lGm惸ɃvoYAl= ݓn:pOJ2Q¶2JlI9#8 1b$ŸS c,?T$yOOMues9hFX2&@q`t,CqR2C/ 8i;^F`#ۺ8s8O\I!ьM#oYeF%s1㌑XG{;u\˩au #g$$gW+ xVYdcXCtg=r8Hi> 3~|;3qmeuҀ;I$ g!q9\D|8;O#9M(Y^9rTKv,WV u-rW}K3Ǵ㓖5jF3bI<G8q0+^Ou[}'4Z {v`!ݰlTA#88h1jw$jV#y*9'$㵶3eP 2ϩxs⎛8D\8#cd^fb _;],:‚4iEvFr'ERA ּ3oͥ3  O&}0nv?3!l rq'={)o j#A}l J'N0O~NG%<1k>c 5㏦Oa3Mzkj}yK.pN94.t].ጰ݂gNd+iiȇzn0~}r}R񷂮fGK~B$62pM9O}YC67m+{1-ԐOlc~C_S{_Om[CoǒA# ^DB2d3Z&Uy;py+CEtA0I"}~kXX97NvoKXG_Om_Q5y$ʄc) fGO7 cF+5`szfD3>E̋o-ц#Xt#tG&I rqqO\W xH{__cf1P_wnFA}OLc\޷ON/<:FMn8ñ' }熧ò0TJ%1kDŽ[v^VUY) HA5O2[Ǩv[ Nv;KFGglK3?ozCi|$G¯ hxNM 0rzuxwOFn 2+ĸ@927}w?֌lmF=co:'{Cxvp0A\spFOo#ih`SFpHzsWՑ+dƭ.` ylzD֥kv>T0?89kࡁmí<އWUI?#G&`Hr}?jd#O/x岻y?@ۣ9%60Itu96Y-7VKMdT9?v7d0>vS/龷[Nni[c5.ZhDvH6Pw+ pqMcg,BHq!hen۸Bq߉ iB L O-ԐːHUY _,FI8)| t;Mpɩ&ޗMׯ߿t5},xJ[1k<#:g y.ĆF 30N:ב|&,$1`xOr7epx`klgk!@Aӌv}8Tݩjgt.n\t8(WA48Y@I HmRc$,O7|d2FG5@-,-U.XTcҴ.6z/ey^g*I?{ h:6W4XvDȠ&bI ` rY]`Ӥp39b8vy_I6y4|ۭ-#\HFy} $qI)t?0q~֗uenF X O5GWXvORNNH#-u]k߉}I܀O-nD"ǀy'=loQť~t yRWvsZdOMn);GM$k@ki,oml-"6:6s#Iy Ro|^i˼)u P\69-\B{Yc. dPFҥ'q,:q1m+ՌhnV6WXLB=u y ÂstSkގnu&,EeuUۀN;gzHvAr 9>*V= ˸@'h|"8Mp9no ^v]#+;^ţ}"c`p<B: "DX2DeS^tYkE#$ftˎ'g8s_0,,O#8$gE֚o=m=5_aBcl-ʮm+IqsM|&RC # NbY%vePA`s9TG%;d7pOm5Z;u}V_t$"MbRHx[ F@眱ݐq"GDm K ǎ$`rObUG|Wq0Ā94Ȥ +2˒$B3eO=<, $S3?201HS \Y|趵O[$q+#pvG#=>\@hBQ>hN9`:,:MFM鶯MKu'nY6(*6W-B309#O S$|;I ,T$9+#h- C ms*9=Vʐ[={#w-qʉ*,A Qnؑg+AF۵ cӷ2&xvHdpr\sFFG Aj&͂iHMz?rqq):~=R7nPoZec*'h*p3 O\m^8M#kI GNXu28g>R"dVH\ 9 qgMuf6iAH ?հ*@I0\uNG4ekuVjC/:"IU2w T .|q>g㿎6iO%ãmm oa_>0:{ h llX |9 W|4ޫa;MJXZ}D' sddOim|_~c~WӼ#s޵d}A 1YvR ԕóQG;`q׀y_~kTxڶ%mHNw{ ]^ڗ"It㈕uPTzpqַu9+;z|ιԷ0|Zxy/w [1*W'>np+~>մKeK+"v Q炼Ӓ{K{M E<iKƗ(BJI28#9?#?|.N_ld#x|]_Kvצ,m̤[ seT"w.A=@x8nPx^ׯ.>[wq~ZKRJHAT7d_b@0ʂ#546a\ƪr8c<c'z- p98; 8=+I1n@$6c7=G=9U+ZM}K?CJNƾh H3s F뎧90NE}!5Gvy|r*IJ`z}o¾l`mQ%cn]=HfK?g|HkaRK>b yXb@W'KWotRdB$2E,:H鰶( F9jY^0aTCWA؀O=:z-B^Es B[*p98hk^4/L&q2݌}ќdWqC.׵ 76ns9urW,sӁ?_/8cGʱG9T޹1ui~bn1s+;ɣΊreA;+P88#ڰ|W;Z He=x\ҷ,O#N2J`('rk6I2%{m>icGB pp95>}y%N'\־'x/~ys >$Qqq saㅴK/H% tPwUs;i7<qrr{˨OjWߖ]VG1eHpF9ۂyY~$ >ZOEz_EhWfiT\D'~8j[oKoy*qH##M3~$@鞠}{`qP˴JDr@c ~| Xu|T${EmL60J;c;A#82‚ !bAps r x$)'B60WI+Hɯ{]vv,S,ǨJ)Yw:`q`tXvp#ʰ$|¤%ĒA!j!WH?7O8SDVO]wp Fqc D.ZҶ4]z-6G-]AuR3#9wJ0mp<O7V.N[9'm Îخ{]X2Ѭ f5[i8 ݓqWrwz%Ar!_5KB̛?aP[ j>#a#4Edw۔qI9t겤 .݌τf~]g!oq!7 \HHWݰ,d8GJ$OO$HkY"UCF{` 9rHϺ=k+%c[V9[I29%rB/5UȾH5_̍\sAǷջ JgȬ{-k#(B I^q?.W;xRK%1$~1rxOcW/hw*ua{z68WZ֠'IϹ`H'ӿ 5~X5uұhZ^ilh _=c sWe:~(#txei.t;"v8+M|=5(I&ԭmYAF'PAW%ec/V;UԨ"7y0w1`9/.|?kl?Eh?N~i'DQ4f shah- l$_=kA74 ҡҢ#< Y2FA~xC>_Zii7?(=W=d\xOhLE{8pkdzW۽ m8Yv ZI- :218Wx6OfNFLQHzr^$xLxZEʸvCaL _yhv0`cYseqj1=zA*XD2A*0Nv`v*;4' el`s<2z#w ?9p@^pzd-TCAf \HI <`r2i6mgn]y`!fUrTO pyi"DH /]8$kЬ|E4\ၶWw=]H ^ᆝw0۠M;G?;{ԩ)G=~}[[>߃#˧e<~dt`l@Z^W!`b?1`=\fq~$RI<D@ة'>Fzsc. FcwgcvݜyaXqx9qNycǙivV*X98y8 /c}mi6B<TZ=i.,qHl|+qַ%dnFcV%ps@s@Q*uz=H~+όB `ًg#*0x $s*2!^52rHS}s*DO#E-H<\3Yo⥜@<imVm5=3284vo-qZ|ΤPiSRGQ|}?b^W# <0 `dc0poAC%SM k}20':r8R^VmKpnet\/qʖKy뒉ܬF# p@p28~Gn?@Tic?(,89Hx;2#f4t߮%j_~~aj%cͤ~L9b`tVcFv]3rqdvAo k]mI%CES`EqgOMm#u;xxLw;r8}ߝ.H*࿍GCmW`pNF\t߯8<"d~ G7\c ne8?B~(iFI!j'! v>cHQs`[6whvcvjmS9$.I lu2|k]WOD3s֧A[\s^>eꚤd&Gq@30 Sr3׎^?:/ W q2*XF8T8c{;W%Лy HbL\^qs9N\s)R6aymԌ*~W{-/FnǸH$ )"*4?/[]Hfcۮa1s;}~\\~*|j񥶍oW-m383\ҶYi9M| ;_5Of,sunͼn.rO$qּwg_|DU{SF;yI䁁^xVEU{ $6/݃oيIzw\NJ8ʻr6zsߑ\¯ݛ|/BcR\Op@:2H=~o\hCg,-}~xȪg:羉 e@GP= UN_O֞z6_5RhYfyG dg+lT%}cu$W2>-ġ]dweR`>Q ㏧ڟ2advSq_Ac{^Konr# ןďLTwۛeDDXp!xdg'gpGqO{ܗ;,':Ⱦ d+Rw+r"D91=.7_/Ȥn!Ju0=3cE})U'tc'9$fWma.vm, s1xqM!@2[25xT),sߟ4GIPw ~{qP5G?Ik'[?[D qŰszz?dOnC,5 uu` Q1?0I9T->=Bhՠf8'N6v~M~?uRҼ;q,zeo+ NNO$Fx~*êY^+&$u8=9_?N=K$4;ٛ8E*Xc<8㌂pM| _m.o K#.y G%t{+/k>'i]:j{|t\{.^=AE8\ O*?4N@Pr[I+gc.! HXX&8vJ]oޏmy?y c7К3*g>[m tH$8Ȯᇉ V&]pFHyy<X>٦K;'0'rOT4rO~hXMma_pЎO&c d2^`SGk5ծJ^F~PvcTܰ-:gX$g9$6zٌq X$z1=ss|GLnmd[׷Zdq^"1g;eBSNv?]#G]F]1rs el.Ia^_>-ZKhw;}Ḟ܀1xA qx2=J'}0yΗ?ࡾ=EVMT }x\0jۡIM]_{i{5yk_C|eG\WM7Ad9G3 ;mXTN>F2 FW^'^)i{ðby`l5afy唙D,9eߍ9ԫ$Vm_#qR DUeʠ:Ic |;[?yJs,l vt # %y\p)%$nU*I%ݟ>PX.>(=Es(( |f3p_inn7чfpy0zz}ջQ;Hʝ]Hc9<pHvac2v=3߂ \C|ə~n|<0]VF|wRK=*!@!=@+x'' `lxy/6ĖJ׮]2YR0q\Wq!0/'q8mU_;5u[}!kg+|'kAQ;l^E8ܫg #^mt W<%y'# 18ϧ6|3ЋKT+Y~Q;p+k}Y͍(I@2RA w9bZ?R+WV4-\0 N~~voo2:\pȰNy]1GN~ğb7VJdQ;`rWh#Tx'*w`K|Åw,F&[vda*XT}a4il2> H b89 yl9]9(_OI7bĝ7V(*QNF[vqܖS'{G<xNN:7HB+)dq)<ߌp~9E?x7il 0}8# NU6RIi7Ô[(@U:;~R3p1 3|2D{!)&R1 =BW |͓ ~,I{ U?{(9nPdZ<' 'w#_ =Nzu q\usTݴ@p$d~e+P>:p{qޕVV!< wd >Z{*KWv޽_:'&ծ~j?;)O(s=G9 6~[d6e~p8l|0_2L.1 =iǨI2yAeЂ{dMJUqRﵵӺn~j9U5WM\6@ N7c< vwA ƶv@N1~ lhѝW#dzQւYbLqŐ9\gzDiM&]ԛ)'HAy[% SHL>G>5˱0'Oq55)6 B7,=CX A iJIO e ?^$Q@*rrOs@R|?yPx?St~w<*|#) V2IAsgO+EPx[ZuQʹP.[E|a8C2 #uaA]ȣn|x ;8ou㟊'5˽#^uE#\g{d fEYk}hHOi߄i+ׯ,pVhLLgpdBύ5 ǝ9%xe>'ƛ,i6R n#;rFўkk]OǺC.6\ WFH4,ÓnZ{?C:j6b_2;@T'Q !:аܕU,M&T|9 |jнPnK/xF~V9; Pł-S d[sK!yQL FKzts6;*x˩'9$W GΖhnҼHU)܃o<+ǴF0#4 0ASpOеg< |t`2zzn V;Vn !sᅚ( -)UIo^8f' |:/a*Gw9$OpփPXΠWVkHẂ`9Q>/G׉;CeH,RFr@ ;]?Me_v~ 1[ki++[U$ IG-/GլVh"/D]1x{!?˖_$_6:MNj} k%,\~\Ak;y#x0:g8ym?4OkN-XpS{EyLAe#n@?.wg:Rռ"QI/,t;?Ҟ@.X}H׏%b]Qe" "t%9+Lﱗ`e?I̊@9 2?J7MF)==x!psn޴ŶB3cHźCR;i':'}?ZF Ԍ(w_{::qI sSZ'c'P1;Gڎڥ%s8=* lTR( z u8l稯?V"Ewʐ.$'=7pB3iSc}D س)AFP3/0#^_2v0=['=[Nx#)P9<3tֳjͤͯoiWWΧmakERr$1~;=FXaɂLq \n9o'ŷז&7zC$vџ*7,,;~y=:u}\#@9F:d7M8I/vrԜ[S%o%:F<7037WoNC8տ~ lm"z>2!KpHd N (FwrP@SV=**sp}i q.Y&翦ݿ\܇ YYBÕcL\ .3ğQO:}2,A"3d:r}+D[ig5RsNN`eh &(Մv+FO!8$MD_GoOϭ~Ou_W%䙗#Q!G:Ƿ%=̐0Au 1g$>'03mrĩâl@@b%`a1&K Ҽpˑ#M' Vsޛw|ܷ[,*Q[gp/Ԧi$L!AN2Naeʗ o6Ui(] %ksèYOF?PCpp+ݎ Wӝ9LWrpÌˏO @J⛺W-;~{hDFڂP +Ƽ³тF SͶ&rnA l;zRɑʴ4pO.>lY"ġ· nX''!l<Фb6$۸@ݵ~f vm Iky$1IWʏ3m. hEGolU^L2*m(8H1@rmlWcF݅h%x dam7[ǂ DWBFI!YydTo'>Fֶ+{eI]˸cQ䑻8PX^kay 02+X`*v:eGr(XbHvЪ6#nI;ZLʭ亹-m/k/^kC^y*'oX}nŮͬ8e,xn8}>c^3I|4EpXՐ[P>Aڸ.]Hossrhu7wyZ2w$c,xbp8T\u"E1̐bLg>HFd*Q6dsH%a?\i|pp:(=$㮊^uĕg|K-n5LOG-%a s__xKwn`=Iab$`dv$|hmYn1#O\?@irhߴ Zi>=Ӣ]]Րy, ۞+54Ve\e>VWmHiwh'dǾ-ߎnu.^!IKr.z ѷ{֡,Y\I69;7 z ~Z\:ψtx=PΟW˕@`sԖM=Ot鄴VC_E?~xA$Tg3yy"'ry+㋦F%ebدpX!xY񿉵w-q!r|^plA)Es`o , |LJYQqp"vH u%R7:tl^H V#' `r|ߴ k +pGrfS0I5NkC߸Dg2%ے%rCĿɚYeLo\2S)Pvm-6_/RܻX;ČѩYInx^9$oZͩ! 1FIe <.[$DX}G Af|ebji |+P18s$TTQNRkj_ נuM!eB6| ([\0fȐ&.' 89('l{In"dQpH| 0jq#R0T ʠc(=vҌn% {pd{t0]VgNq-7W)GIT0̿f AW'h)!pd8e4ʉmG;7)$Euj%?(aGRT$6qPW꺏V5...ʘ M* ʜeXCn<?2)tu3]ň'BI;H'E-,ʐ5bGsЀ9*p_hWTJKܿ`!GbiH`B>#$2 kՉ6`QXn [2ʱrTKT)ڤ.̭lK許dDo8R8\lѷP6U-^ą1$u|]2/T1%s.[ݻ'9l{sm+#L|Z QqLgh8Mh$d3}0*Usm}h2dFt/C[ynp_O" :ݦ0pZL3-Q&q([ΑD|8^zALĀ-dVNSI"ZB1d+=>}qDw}]%ሰ/vN9709?*;C %ha+;BR9!p`pjG`DA3g-`` PUDqddv>\0y XJm%wk]"XVw,\/X;2~CFKdI"'a!0-2 l݆*[ddH<1Xu X rx yM[ 9]^?ݯ!YH+3.C8"WkvA.>`2/\%1Mq. )vUݎN $T=Y 3}Ry r:=+K<FFpI=:/_gE)h yD{pAQqaV,{pmn +$(/xi `(K/ 0dqЁg98Yd-,s(fB'ۅ# WOI @ ds<䟛+Nv'ugH#fĶ#y}9p}k 詧xgȹ6 Hde\ 8={ߥQ4ApUC09='*^w1r^ϣ)eיu`[DJQI$󜟭|I1F@ &$g0\~u/]kp̰So=Nza\,dpàdp0IͼHz Pt}+-TSğ Z[C>^[sc7|y'>L[mfTm+A6tc#lύ#I&uF9  kfZ'kny|Np`Ɓx,-jI&sA#qJ&Ɗdg28-kCeF[Y6Z69nHUuVmծ~xK_ci vg<pdL5ŭK ԾoQ 8'l޸99?? ;#y4S6. $?(HU}/ĽzKk}[ղ8 w7Z=\aq܎Z00I瑞4*,ShlLSD`n'䎿G?O|ȅ]$~x7rsE}#nIT\Ilydzm+x65 mCˌN~Q2+^S2O!Gln9ٻ _[ȄŠp#_zs$ʒDy$ SPq|_VL4/ݏB3ױ7&1VxYYV2yUN#alu~H HAv8dsL]ᄼ<F+Xjv^om{=Y4Fyn7RXF,gv ?] 8 0@DFwfA;i+['>oxn0|8Arw[8=x#5NRߥwKs"TDg۴('8ma1 N0+D1%V6܅r~QNw>`qH0mhr]r3 N3<L> }F1qvAIW^N45YicyXp]²9-Hla/&/R˵2 !s 63[@oNǂ-bq,ٙ\pNA< >)IhϣچSHULG3jnIM%Z]b켙|)rFq[p2YtY vm viP `~j|;w:k9#-~Pv=L4߯_u{Mȳgb>U8rulL#qz~ xģv\^ю xrFӁ@#i;G9#xKgOƮ_)#,G1N9WhJVQ+'dAcSۥA2H1BJ|F #Vi%o ͹?1 uqpvҦm岲8O G]٩'}-춵.vʹ,I8<=%6J&PIl<3'߈9dbJ+1R'oxr,CrdVc)SsmIuy]#n,N["YE g#qW'9e<xR3wYh4-ĜǍ瓑ÿOEKXF1ۮ=1ҍӒן~D :u9veV1[L@$8zqK0Ȯ~r8<#qNߍ" iOlՏv{gï%^M("is%1ϰd}2s~vJ+o 6.*DGϒ)lz+J]جrr] *rzkAZ3̻RU2(lُ@2Mn5Q0HqC1sW}7t?I;Eq(\K9'Y p<ɲI'CgW'S98XZH7m71.))EQ&[i]q"r+s8lp} &~:ɥ)w .xV TfA$8l*8lDEc9PHz*wznm?,fmfg<@i{R;F0A!+|09*u%}/˂s-yI%4ԭ]}u3JMY/ؒLD#XBTb/T`G(f1U$P?h<`  A[*xɋ+:ٌz=O|?J_  A=OiMh];{(~Rţh8 DAA8 zdTR\G5H2 ;.y?#`\t%`C!֒eἔWۘ9>mk MsRt.[~[rL>ڋRݿi6H}2\c=F-FbO!F]J.1wo&´Ppɂ ?9<{SZN[mV&'rp~j\4HvOƅ]%Q# 8FH韧m$DYr8rNNyk'3KI9v{1}?Ʈ | I ;rŗ؂}JJ[nEY~L^4m#R6ҥ'[DB8 lsG q;pk%?`1Ln.$l],|.Ӣ/4w ngyzP]?ԥ~o T!t*f=zR \=rD6YBBzqgq}&8FCC9=G|~=+J/<^~oFsq'gm |C]Bd'/<`{ZᦦQyQx9#_ Z-I# #@O*ZM V.s@=GZrߧ'ʶm uYdV$11i'}:85r߈/\Gw0e*6I;9pqLu'Ƥp}:o&mUA8zbU7yo=P%ŷm@vnmE&2G)=`֤wkao YI>\0r1ds$ šd֢Unp|;J>)jV"bdO&Daǒw^{?U+![X*@?@b fsхC u^I?f_?$_|O1>; g->%; 4TLBANNOxf}7 nCǂ2q!9X98g d=v0yw~"/Z'Ƶ;sԇoL=3ӞJxF[u lߧNs`䜁ctI߀FF_h%k>" ;w3`;F$I]?O F,rV5<^N{c J`'zLc 99$N* chYAPmoyǧI\z_W-\mcBRH?tp}8q5]KWTJ|I8;88<ֵa#B2Mv{d(7<Ջxa~ćT1~?69w7`FM=SLҾAe,x Ԏ $$Y<9^&ܲ ͜M3d:^~K}9;g.X݆b]y0ÿA\h|i\<֖(W1iH,OAvfb= :)&V!TY~Rx r9=^W<"__۠%&5Q, T~ !x ̒p2/AMForSkIv쁎NNz^\ pdp {1g@9%{o53B 4-O ِNCq/'W|:% 6܃7<`qtq[x'˸m# ۑ0~\``#͞p  p_$IRݮ Gk|"D7㐁c,{v0{}DqC09Yeݷyqo7PJ㵲$H|$I?6(<8x˔lW<[A,nM-a`2u_iPEXN^ysW{X@JY$Ǯ8`tdw, |q99˛wsֿqhm[]* 3F(cE`G9 לM[MO:Q˙8l eYVIFxO'"kQq0 7?ɧuٟ%k?M\֘q A=9^A$W (<|M/YGh%8'$ϜHXKf#ypKUVOkcg5&7~dMOύ/ yQYup0OT$X1"C'R:@t%=jnw( c1nkIdTyUPʼnT^0sj8Xc ~brI$Ns498e頯c;""1 Oiꨋ<,A` >}ko Z-ZNcemtdU+>Vʁ6G=iYnN`8?9J[ia@4 f#E+$c'iMod3LB*/0:`zߜW#$i>?LZU P%N>?γjuٝӱϞ|1b0  SۀduR\9eQyp @Pƣ 1b)!8%9]` ߇utd =%W` p21N( NGST%BN@'=s~ެT|XNz@bf33)~ċac@߯?D7`铎y?$p ݸT1[q,!FU<xI`Jڃaʬr3stk)qvr34H'RbI<4ϭ64nw<Zz$c #=P0G&ѻvGM&֠鸂x=Ҕdz Jqu>@Ŏ9>}~egQ/N) {P7rr=+g&~~# @^}W?JT8yݞy]H,qϥI*PRV͹t{{Sdm%#=?T~kAݜҘYrFssG쟏Sr;PqX>*9/R;yF q1N3-êCpJ6\F8r?ƥM5}Kpi.+9H\P͎WiPN? n(ЍV65Čf#9ZEE17!8# Dlb8n暱tﴁ?fK&$IҘ) `_ʍKԙT I8R uUfA'n3ϭ86^G|P.wY #3`gz?JcȬFpJN0;w>d8'#8NM; Ao+܏_q@ErQqxD7?O~"#.9[i|nA~ib Hq?*p Ӯz|,p~˞ yV@1$?0s'dF01)€<:_;~$|VI蓸YYU2G$k}mj܉ŷ *,~rF0OC7=ky=:kj>SBy{d.#.~l(,y\ \6ѱeq)Gl1qti8*ݻvݡXQI#%xS%1K[ÁzS+6AIS78!H6=1Hk<;)&H*8:[$RHVݼT ' z'<-Hȱۉ-HnT!}?g3pNzp<K\ܙD{uxRsAch"uS!ʑx8NO.'3FC%PspN[gwgԧ3[ Ʈ#3yg#Hu:God.Nc p060=1M[:H>l*QASLFNrO2EF`8 br4#VlnfbVN%Tl|)TՌ^2BG:D_(Ğ';0|"K˃vق9 zD2FUiBl ][ٚ2Sn$A_$1,yvw taR.b3QNۺ?7 OIS: A]q@#CU"Y*y3d1vXqIU|I3C#X22qʗDe2 nN 8<{g/VƷзkjI\_9==ig18E$pg=OCB3G'dpy!w廀ǧ3ڬ>#+>vR^O=C?$ϖ㯿N{qNVfULJ Uaȼ3,|$z`[ݶDI(Fd5\.C }xU8{cR+BnlC, mQ_U1/Ny֕Ne (X1=)WN$O&9$ǠPLr0rsqoBzi=7-L] FpqN@BNx f@r%JE`I5òg#iϷHIc sڐ)Q߰ČAbs)W < HP`}Qٷ z?ښ=AhssiJjbpGڋ6$$gS{yyA֔0i1c#a'C: P6NO^){y*TP#t 1˕## ڼ}3z0xFOO֗ne-\ԃ@f#vFۏs^2\GJ_f]6$1i ]Ǵ{7)ӌq{~RqێjG$dn B$V9Jzj,lK7Ra(@㜒1Q8q wD"N>Uq])Jy@RĶN#zS=r7@Zda9yd;©r+Rw̑hHHRonx)U`GSE1Ѐ6\jIXPz/yˈܨHfR0?8]az}~I9qIQF#ܕP,I\ӟJϙ`Y?eAKG9G pA>dwd՝KuC# % le$z'A [ُ}Ta|GbWvs"5u-2.0YTw~ȘiA$ip@8p$⳴6[[ E !Vh O$g<ğp#RX8^9G}s<}b(-`$qwXK]Z ' v{(T. z`ig3fHyTFqpH8wdg`v㎘}Z&tby̲,}y$u'5J( OvdtI"B T2NA$zj?ci*-#Iu$'Aд䳘܆[*ܖ>R0FH׌rUxV0H'8v-2´\B f\&r d!ldHX y4QhPB ]S;( r ;"yCrxyEe醗*Z }ld wd( G8r s:o7ݙXEېqN3$TEᑥ[>Cz8y\m!PE3_Q)JF]I8쎦j{F+s&k$q}?^&VDy%6ڢ9FBVԑD'۷p+&0|ǡTYY >Jk|-ܝ|2I䞃Gl]]8FXR2s'@5 <.Q &qpcw4ˈjD Ź8pN9DZ4얈N/ T#V^'̹{}z֣i=۴yGpWv7c zs=P瀽|_;Kmv Ǯ?jYmQfڲ R\p=}ci!!wR@zv{L,аfbrI@8tS,႒{z޵ ʪx<`7֦F @眚+;a\ssl}qRoFBO̪zs7a뎄~TxaF>Ξ )^}Z}"q6@:6HF؋y'JiHWc#Jgăۂ'?ƄVbgpx?y5wOqPs*jac uƚq8Rf$2emxTE$PrN{{uH7Ku_N{AI/*1yzSsR랼RYFGͷON:IH)'biB N?4s-רS©b8P 7ػrqqNݎ08n?*},4-,@#О4J= $-Һ}Br2Ӗ'ĐFT|p#~8 '&a1G6xN;ٙ~|d8)Yf;\ye<sM0;3x8UsF#iC3N%3ć?)fʀ{}Ǹ|M|&B,0j}+`ܜݳ=캜w!qmK°@lON0@kQzXc]A(ln`AϟQ1mX[2%UCa39E-mtBҥ/̤dddcʼq-:Vr\M[^Ot+tD9 7l` Lw>dwm$1F*B˗@j/,' Мd_2N<Py^_z;:0+뙍hOj csq??):|)o%ÙwmY~V*,o=x#1ffɒG+yKX%1^&Y \0<7NH<aM&TrA,11,%6.Fda\,6矠z fSAy">1`K`gI{ 1$䩵r9TsH'r {S[No#eRvy{g&gE14m' NOy<60nI 5*K{,8pNߘd ]?Ԇ_3m.Vi1 pkH+ӊ,Ϳjʇt߭bgE"7<<(!s0viV3ԏ7wʣKFh|̡FO\EWte/$!OiuWuѷX s9f_0\C2'8p ђpw]Bp9Dk; -r==01<s_4Zoč냐9ג>#(F=~2U=0y q 6.fbjtZW<6YT+!=@8~*;mEnI,d䃁~G Jc)]R@A{Thx`NTszg /+39p߃{p\x9鈋2ɔ'z7 <^AHFS7Bqyi_{J _}QwQ׸Q$S;&煂06~~VFHA/ el +=OQڲoMnWx ԃ}Q8BRYIy d?wo<N*Iacm&8AۻsՖnrsp<.NpK}?䅌jVqH<~4O@`3u9RYN3$.F*) ,s cqSd!2X ւi ͋6@7ˎ뎾tKɓfOLқuv ƪpdsO$} 6kk9#N! P}yjVyd&I_ l|9u*9miU$=WzqR7C| ~Qr1PI*ϯ׵HIF9Lh"ʪЎAizNC6+_ק9(;Gq.֏<*aG$lGA xP)b >7fФ'JAeQ{{}bdGj@'fn!_1T+ǏQ^qOG pq- 9Pvq?_zVTm,G,Y|8 OB9,k;VERLg  :~H 9B.FNr9 )+?2$LƋ@Wqӏ_}i $3OU:;cDr]aFpvs=OQ$;dUE2r8۞ϧ* ?=’0G֚Trzgޅ5z А(c ah. 0|s x8t"Rvg'I=z.8,ooj qԞ?JYFvFN~~q"l!_~,dz@$U0v #:$l!29^ð>Ϻ@>qOMX8ʤ`A21s>&'snkk_ًRO$Ud$ j H+#  r;N>P?>k3˜X'%eBgqWH\]QTedRTK^q!ǩ[4b%!@.βnd*('x*H4޽R .҈1•$dd Uh$XRTO8\csJi_}B͈܊QT'yl3?J6 E% qJj֫3qoG%$𧓐zXzՙ LQxn$Ԑ@p^SJDUBȐP9{ c?tPB} >e1g24ɷs9  3nF'䜌np$Yqz_Y,RcX$.2iCv50K) O 5/[Vi[.ϖʸa#"]Gr$˾/¨یG$sً{BDXA58BVU`^oR8w۬yK %wd'$S.1$l )$ $ 0ht-KlȆFT$m@${r"ҍ(ɶD8T)\vFr3$$EX|VE= t ђprK˹"--H<(V 6v2ͪ% kUe%o H-o]ȡ4D~uprKqFyj2qQ*dg錑$]~Hq/_ۛű!ʌ @p`U,C=tXAy0:g0>aVr;F˵PdrXwĞ0WQy'3&C3ˌ)=2H;@"MuFvpBƥѵr0 =0rNyw,wK`,#oYa`bv;\{p1PI6l Xf%$F99f#${N:II%5(ejb3m\{[XQ(D)D"9G]O4ʲM戶pA qFaHG4y1G.NݹW28@릦,/}j[RP)[z5-\K,+$Ͳ6Hp21=y$ &%tsߩ'$z4HO,JdhQ'mǒ6}楆e & n|UxbhDȈǟ$H67qc婗ע ӼvXts q{>lMe`769MTl?pc^ N=}jʌ۷GBxڍ[3|̸XԞ^G\ˎ /3JĈ2xED%9UR`Փ92.%p2>?Qzn99gA#38gi%T$@G 1#g ]`!pO85IXi[ :>bp?Z]ʬ@ߜrf@q!2G^_ˣ¹d sS)ˉYYycgxd䏥#ʩ ]J+R~LIL4n6%|!G\"#P0rX';xqSGn:dېg簩 2xC#Q7UzϓNxb]Psi+ȣjgI8xG(]1Sg#9ǛGpI/>U1oX^[}Y*@#''?7\ǒ A <77::N~bOx;}iP1f&; 7g'<"6n@r}W%;w=M_.W`ǟz ^)x" },eBB\d1g^ sHw#e LVeUd+jX؛jȬ O#8?FMs!G?HjZJM#:U'MΊK ;T.a*ƩcZbM^1߯n,GˏOܿ/lQR8>zfdB a/$ס9V {s`fEx|p{~y\,0[o'N^O@)|A2qp:g8@۰1 ,Gׯ֫sotѴ. VF|:QD}qsө&#y& N0G%wr9TvP+H`m]<g'I%ٸl^JnqPE)}]ߎ098#iŨ*`>qXF!h?/~N*5GR \<},g9FG܎߲lfQ,3D0 d~{+ڠF႘( q`3ߔb||lQOP3t=F_2G*af'iOckrI;R+i-mUc|dR6Kܬ^s"}L|nm㜏'6 K*f(\$ X!}ǶI' L"7r4v,ks9]-j\ZP$D mgOnWTenHB9m6 9Cp18ոIY1+#H#wҹ] --ų>o1Gq OG~"Ƭ0Po* rVVg ,0ld.C` 9UỆ(H6Lz|s.ӮI_t m|;yOj֫!+s]V:d !DÕ^8'SlXdy͒ű `rT|z~JcSЁ01nbhPq,+NA݂*#4^;Vdo4e9O\&r6JOb-%WyrA qr0HZ,fh#0rHb\g?\G@szcPn".&M$=O#5WI{$iF"IM7 #NI+ A$`aF27r8=8[^YCڷur3##m3ԒTDv(RHn ̉UUXPA-6ڷT1DA$cʪ,9t#"xXMvyͻ,``(A#CTgl>IJ'qϭ9Z}?жkꉯSӧ7ȹٞ h`dX-0ga1N(8@x s.fKs²쫼'''H9 {SM#O.AOGٜ~f*׷7KG7a[pKݒ~^;#uh4!97mnB!)Ǩ_\h"'>R:*! 99p5p;Ky2%>Kp:scdZ2בi0洉<`)GO [v Qs#f B`poC}9-uqv֒.dwb7|8NVL.BC6")Br}N szԯ}kOЮW+eڬT }y8,I WVͷ$Q$2Fr;B MT-j;,kKŋ!r"2 t͋=T۬("؜B{:뜃rVwkrw$'EGpv-2BHۈh?֩D[k})"OJNxcJ2\ó.C.H̪IgtɈ !bKPa NX@98EAiqyrok#F6H:6&5\8#$ɪe{س.%$qmˬb@9+԰lۂy!N3$1 ?OCV>Φ",/1SsQ- Kr2;1sO ĎM%6FqO_?Z.QU N$Ni"RS|pG++.yѮ~"KrMPG}z$wJ~ͱOX:폩,= ]v:1$,?`霏Jkl^}!)21*1jŭQ L+0s|.lHh PI8`d|Won߉ Cp-+V2G0 p99 ^moĂ&[ۧsN6 sY'q#n=szu 1KornavȅWF#iIs,E#Xc+Eӽjܴ36$o<4Y8wCg^%dʹ1c -+.  =uґGB e9Tg#=;UXd bT 4jfI/uحgJ,O˒  N\*qaNQ[lisg'YSi@CM3|11cNwme$*x`pׯT?i[{rad (ϮG'"7G IJ` s:I"K$ =*o WWճaVbg?jC-Hx鍸4>[W >@{SL9+#m,g8x3s6|VB211ׯi4ElR\ӹk6w`I2Q Ąo$sԒAS?@ACDFGHIJKLMNOPQRSUVXYZ[\]^_`abcdeghjklmnopqrstuvwyz|}~V +`` X3C:\My Documents\My Pictures\911 Pictures\My 911.JPG(L(xeX(PIC2dLPC2Le((xeX(ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3Image1Data Object 65` 2Z0`}.Contents0Image1 f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P A mz'5c& a(PkYLx~v%Gh# ȡDr`[{@sy`D!raT!E rncNb q>4 s Fçs nG(ĎHM!Q!p}"qImP74x%6-S !S q %:TOCu"榑ȣ +M i ̂L"T=gQ_~o2(%'; Vq鏋$S@O{郘JO!~$,2è v;5|W4wn%;jy1]P\$a2Ol@Ბ'2X/J'H-0f!ɐ25Bf'n[ W-,T;iȞm.b#_kVR{ 4'eJ/ҹs}Ue=.8Bt5L5,%8fb޹ҟ^l%޷+8/a[v0(e<a,R\'d ѷ-$R*]ѭj4><ˬ7%(ҠUh6^d Oڑ^^@m]V +``P.E:\00_Graphics\Templates\Gears\gears prev2.gif((PIC2dPC2Le((ʦ3f333f33Image1EContentsTData Object 68` 2Z0`}.Image1W33f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P vmtҭXdՋ? V +``P.E:\00_Graphics\Templates\Gears\gears next2.gif((PIC2dPC2Le((ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P =NU % )sV +``O+E:\00_Graphics\Templates\Gears\gears up.gifupContentsfData Object 69` 2Z0`}.##Image1iContentsx((PIC2dPC2Le((ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P 0ɪ4#j3p.^V +``R-E:\00_Graphics\Templates\Gears\gears prev.gifprevious((PIC2dPC2Le((ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3Data Object 70` 2Z0`}.##Image1{ContentsData Object 71` 2Z0`}.##f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P &Y`, 3V +``Q-E:\00_Graphics\Templates\Gears\gears next.gifnext((PIC2dPC2Le((ʦ3f333f33Image1ContentsData Object 72` 2Z0`}.##Image133f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P vm15ɨPW iV +``F.E:\00_Graphics\Templates\Gears\gears down2.gif((PIC2dPC2Le((ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P ʄ Vn֧äfV +``G,E:\00_Graphics\Templates\Gears\gears up2.gif3h      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefg4nopqrstuvwxyz{|}~ContentsData Object 73` 2Z0`}.##Image1Contents((PIC2dPC2Le((ʦ3f333f3333f3ffffff3f̙3f3f333f333333333f33333333f33f3ff3f3f3f3333f33̙33333f3333333f3333f3ffffff3f33fL3ff3f3f3f3fff3ffffffffffff3ffff̙fff3fffffff3ffffff3f333f33333f3ffffff3f̙̙3̙f̙̙̙̙̙3f3f̙333f3̙333f3fff̙fff"3f̙̙̀3f̙3f̙3f333f33333f3ffffff3f̙3fݻwwwUUUDDD333&&&3f! P "ZUdmYclIFV +``N-E:\00_Graphics\Templates\Gears\gears down.gifdownV +`` <=C:\Program Files\FinePixViewer\911 Restoration\RS WO H1's.jpgV +`` )C:\PhotoWise Images\RS Bumper\Image01.jpgData Object 87` 2Z0`}.#o4ContentsImage1DData Object 88` 2Z0`}.o4o4 <JFIFrJFXXC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222<P" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?[,'h_jnSkvkpY<o=H$bu d`rB@c?grN\icisZHp҃\ % Ry#3y[?a~Se|qZG3m.Soi_u2{3ЪPeGOy2G#JrB@I+ơ2$N@$zkt5DZ=0XլV&gmVW]m̮GNqTv"%nF؀wP2hyAboVW0 =ꖙa#s9%^%qpʫZ?T\rliy˱X$Lc*=Һ[-v t<n7]R Gzѱ׼z=h!Gl?zXcjCmxXn,>&a~sb|Kp0~4Z\c"8&$3O#sjcs=,pz/y,YdSߡ&I[T~hoSjl;"Z gp7W_5iìM,2Z*Aj9)5G(m?΋[V;pxjoGSW\[683ƹ1iiC]X[At1ɺGr˴=lZ[_D=ҹ>8yDW]@!oc[^mgQ)Ƞߞ u/ C$e#@*=ki:sewAcE9$cR-E4k4q#*pꧮ5_Hu?23zV;bw{:.s5rHIS@TWn6^\& Im"2ø޹j埊Żp˯Co]GEo, ~i 9Oc׼MIxdjqxu^p.Aݹ-Ɨw@+𕙖YLFPuMMH>kXr[)ڹe+FJs^czno~˗7F;tz+;׏]y.8HV΅ D[?Zq' ibE< ƾʏ/Ltd#fT7/lS)1r. lװSTF7q"B * ce9ARC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?Ãi,H=+F?8ALGT4}JH symˊӷ=u<{,זPOǯ$ I mT\[8dد'wkFjtfp ;Ecc'JE P C+\8L aA|ok ŋu :9S}tF#6V9Vt^!'?6[Ԧ?QZV2c캾o7wArobYfHCMj)rIo){ka Θisnvdg0i=џ]E9SYzNE(nH͵v Q=X"a >\ r4G?i]g*"[fhjEi'BA {eMJ $VRáT7sG3/a*6pl>)Z%qO 'D=FQՇ'5 . i)O+'~ol|mEqַ}6i/2xa@̀`ď֐ߠSG\Rh !HYFY9Շ"/OSE@vhϤV:&8ƌ=+#+ᇪԂIr~ǰ2 {t0s Kn͈s3ISL7F3iۑP?7q=%^1A/,GmߡSLguHZQcޒ_VѲ7FU94q*c#x1_@˅ :B*Xٹ"19(LQ?2A/{оC@_ٙsX?{h\ziFlN$f%RjpNh bܝ6mued`2q{s cXm]n}@1hS=&~ui?\(쫃cK-}F4nYozDwQ3mYv[?p'IEFvw*,#ӥ,LwI |mMa?ʺO/)Ql`~})ybgQu9bt"9EJHaIS<SqrqRHsޱ?..tI~V1o/?JD7H%uB)vh ov;I yLܛL oC?mu}hB獲 giǎ ;*"7).#U(?/ 7ԯo 6?O4.?Vu](>\fdh69*?GAz* g0H~d#4\?.1֘R2 0Ӽ ?C\17?DE_w;p͂_ T9&_F[QO䫂>( cT΢v\Cq<$ KKw1<ӡU~^=<U'ܘ>?47 ̅&u_qS `rRHQ2 HR}OiE4|\CT,9`Y'Y~WPzTz9niLe%7_Ę06FGjp{*-0y_ Y]6=ݲ6\ '(e?4c5b+U9ҁ=fS]:(0ݨ'1M"ƴ 6nF:|}#$~Y <GkX{?hg^uܯUSb]ӻ #"9`1S;}BL}Y*e^r I8Z@5H#r6Gx럨ͧر7lWQ9WF'a@ MlTL@cʗ&Q 7*#HoBq=^7Qm/P~))Qsj;YN2ބFÐN( <3ϤG1"+*iLKLM˖uW*X9!11(i*Oʟ/,Bx>?CH5i~g]߯Z Џ,_CwM4S$*jFhOWVM˺9/ 8 =fIDJҀ'#bxRA*B&+>:?:gd~x/aON?//r bvU+AVbE:H3 $??O iNeB@?]ȟcDfQƗ̻~eޅ.1̾6ƙAěoIoҀ`Cv@Paʸ4%L0YPaTdm3n?#?쑎`XOw/i u#4O/(bqx@<]Cۿ:~X] GQ?!vﶓ`<~QP@FzFߎ)/w<$m'z#G?Q`(x0 drJnC5~ʃbN(̼͏sk0ǍQ=Å`J."Ǚtv:q$xu&>ܿ`=i&nT6ʧm#U96 Ԯ s*m]@?AeǚzۡŤ{G?67W0 Oz\V=^oIuEec30JԂENkt=T,WȏRGT݀r6),cyf .)OЊIُ?kJU=7+R걌HL?A( C{+5#ic*`"*Sv ^izopkVlh LQ{ ) ٣>imudp>ϯG'ʹ<ݸ\1\:atVIREoNjA#2O֣=:FlCӚAgd[첒?*.1$3 MoV&L'MnH.7pX=ЃFgOW ?1F,A 4{8vhEO1ȭZ}ī$'!J9f)U`jO5桒c-ct qב3PKki1̖O`>ȫ/f;h4|3cZq?S.?0慾c=USMpc??})\!s)o@yvCd~b(&]oX=f+Br4-  #L}n0^ܒ ǡ(EY?ٝ?!?LG`84<=n:+]˻8?1/ݐ?[Yyé;YQ$3UX'PԒV6m)gOW (쫴c(]SʻO?‘d>-%Aie}?8?Ÿrqt7q[ G>`t[n1vғ˸O7BAןSƪsq,ο&˴s/M sT]E>V9QTB.S/ zH^$prĎ:9Th#ӥ'prH678y?2|QQ[n _RHO?1+GȎ{:R} 63crAF1cq|MنQAH}~eJɝ?ʲ6SLRE2"!$u?L0H?𧘭?x?!dW20П1i% G\ƥIrIDe1H`6qg`C?:}7˰g2gT+?+,~VTm27] W ! 24_쟙.C̑??yGRy̰ZBw˨h?. yylz$ GCѾ.'QQpx5]J>zC~FYѮN%yq)'q2L+])]'LH>mq=#Hc?Rp~4'"kZm۫xez__kj7_hhdX PNI\z3\NKfi@5SзI]ԧ ScRl),u-\zH:ՇǓ +yGTמ1~Zxu[(*=>+d Vͯl&\+C׍ ~2>ѓe>b=frOt;I*vs.4Ml#^7 Skb-U[cew֋G~!䄑`@ЧgjAwB]'+\[;OZxH59X4Ѵs R0^[MN&0 m?p2?kEgkWaxȣP*G91,i aOO$cQaA*!e 8=~<(m3GJ_/Ӡ?LZ#w$g ;q=]@k-ɟ~K*zS8Y78?ccPdRHL14ZK[IEo'1L)_'2恋(&+d~FvrXg67Rb:6#iT8di4GTQ~c~"gXnc~uelȑL14yryȋx=#OCLpUւp>R1{A doMj!u3&n+b9Ҁ$Id%ObTMinNU=l~)[[H۞C}>V'*og]@ /vAc),Dh ecA?KKmLMC c]{}5T}I3|B`b6: ?ƀ5qv7x4́$\$މE'$ JA7ϰdgi?rFmaQZ&MJ>ҟrH678(;E7zG8[4z#?H 8yVBMS-IV҃s<Ǟ6ʼǡO*=$? kLcM:*4 h_Jhă#~\ynYQ Nifm73Tv1Sq$qGT\v!-Ks؊>v"> |55*5>S4Xv5Jqw/xMNKh$p),@ךw7`:tNr2 I|S" U$Cěd ]$UܹሪBcOL }+[_bЏҰ4oaΓ M~̇|=S#J8fDs*} Ti?QM##4*ᾴ E"} RC&no›gf,֓'f_p;6[G\aNEO:+g_kZ/es~.wio85^T ?̸E˻StP~o@~Vͷ'C] gμI5V>Մա;Wrl{nS2\M {f}^Yeɴ<z"|E@OѠ]3k[L{$DCAm]K1jc?Z%My*$9Cr9;8#" 1eH}EK1l0aP=nJl[O̶ѱ?3쪿.;@'z6n/ JM7{8 )~c4g4^2?1+~"[7+)ՏoN(f]n}H r_cESW@`~])v'ܖ)?JwئoZ (IGMhih/ܿBG2 Tb>js G=p1L6d~FR:+~F)EfOHMziH# R`sP)?N;Kc Ά#1Dv` &IGeO?—f/1LYiSL ̑I1@ 7?cpi Luz?ߟJetU6̟rUvQT۲2*>!@2`޿DѼCTojҀ>Z/0zyu.x_7_׿SO(?#*Q= x?z8F}ӏjQ7W= 8ˤu!rWH >֙ܤJ~:TqL!#8?7bWR|E&)6pgiGR&(vjCv Ҝ + \v11R9Ossހ+SO4q׭<{@c",y&Hdaz$TGi3-@=3RG$ tZNyc_GkuzL*|åC7~(!}pq 5>}-d f+{Bd$]aϥZOlIŖz+? H:X~$j >/~1ErOAٛ:X6GWng(P;nWM C)6'{yuqsRY~@=cÏ([`LuSܐpiN/Ω"3@SAx}n[cchONWG(WtdݷKda (7 yh.W=bpCAy#"Du*LTonN|SSCpxzQSOm`)A>ҧgAbDۇO=CE!h4~bDR~O#M6Џ{?ɰ?#J'JaӃM63$'4F>L=loqJnGK7/)LW ^)G|iY# R_8X})TFG("~buoe! M/ cJv'dTӚ͸,BۿN 0mr$ Ϛ`7lmQJnuSԁ?QJmW,:1މx~re~:bٲDg݀MF0ǥIxҠ#'昇*=G4sN,682Ž2ATkp~`1S sCqF9b7(n)s)qF( <Ȥ" %8)f Җ@"bA#Si\:\#pg<QjFigmu.i 6bџO[v(l+Huz'OS$a;r %<;jq~kǏʷu#F$/!s=Y6c*0*o[xsr!cQBi>"&2+#4;$bkr}rQjVO7OTHȅ4}yMzO|4^+kNz y/ TrCEN34'mH;n*,ZݍoѼʿ2UdE + OY~K +w$^$ѻ56rGPj|?c.Qy e_;—ľ[4'I+p7EuOH޻8~ÚevΘxSInRiRZ~2xZ|*ub 3R!\gϠ g+F ,0k1fJFͬA:(OYRKPwzcƝ룉x.4諠q]F0EUW-'Q^jޅ%#rѓul0 ~+WZ""~R}2?:_5JEdi ;l19OJ­7-Ma$4eRDY7 ĸXU>1_UAh:;hkqH=?VFm~U%PԞU Xk=h֘P럴>O+D[k:{~%91#TljVz5;xxFo%(?.;TOjuH#+W`$m&X#!Af;<x.jfOw}у\/ނ)GOt_iAA#YB2,٢t^7 m?1;a&IA8lnAC'⽰:?..5[ђGҨa}1i>_,2:? .ەrX?MPA,' ~}(3L2J=! O_?!Ar72E/1Mh?#R40Jw4(Og=?^i3cG>Iae.AJ?m?IĖ/q@5)isH7mݲ'o'%]ċ̃xB.sSx\s3&??7+8Ɛ ]vd g'/[rF="v7xiEэBJO*e#HO?€<1? Lz6lmK<{vmd` XUii ShOW80史 ݰ-上aD/ROᚤ&R%FL;'1GPڕ,A^IxK_\ˍǠ'*hE'oNn/3C"Az)8t> \[D9?煮I\uMlL&o\ I">՛ ORA*sT"&uH1DlԀzS+bJR pjr5adtdR֔E=O4")N{.y#(9! P>Bʇ3\4-~S[R+Dĩ`=).zVLi5/ ndO ұlЏjG V.-QKLzHKa"͆sj,6?+C ^hm3-nL3[P!%-+KCCOB mhBU ؊ B5hPxN[m ؜}7c[Cڳ;aSSkoBV=̂I[˺XfEgn*'GCaqemuw;[ֳ_YLǚM 0I#>e"QpW_1Կ^^=6plVMt~lLgu@vks\H_PGJxɏKz`5ܷu p=9aǨ)#8.O~=*L\ds?A0aJ>y7 1lsH*B)Q{a] 20'?Ң}Ҝz4gƿ].Hԣ·wĒF?ތ0k6!v\g=K`jW9%ds,+* 컏MRĶCVTWRDU-]>=K57.9wM!\X+g#x[2RnoAAF Chp ܩ7KG\}0E!aAF,|H%D ~}*xv@3!~%a`+=rKC!#Ps@X ˌbp?*{6~Kj &3Пǩ\ e.h읧4rьJ?\dRV`JWep 휟ҘtiONh&|8a& oQVv댂=  9#9922!,)U ?Zr)d$ch2I)*LqA?iu8 Eg  gk7 >n캄*?vCV3^ڜ1uPBªKymi遏0*5N7fi6dE>簮NFG{CM4؃ȡ,KpdF^UOO??OIû-ؿYN@:n^Smk;r^G{j\1 d}E_uiN qXA+vv;ū "+»+Eğ\B㊵d&Yk'?w LF ˑTjŴnr)'LDlv]9ښR 5zTL9EpF {Rluq83B9G`qUlڞE-e]*Nݧ9`ӊOǭ@̀ZKxo`k{Dn+EVJێYz9h0aZM\ wICҺ7R($o|IC^Ozf*UᐌYv~!c]j6*Y{4ׯ4|wVQXE?z Z崚7^۠Z;ʣTRocϖ|tOĚC(r8w0I= cɊe`{;r$rOFKTFw"5^oqː1Nĩ̎'!ؓ#zM`}1֤]>o/aЏ8ȧždx&ϼ=fT"ZZKۥoq@Jaco,հ89r,Ttz_QV7fuK)8T6XVvȡ\STMb[5~~9eMdZ DrTH!x:ًٷ`= GW29Vu]f})4>b1$NeMoi^#$<ǵuw6:w.5皮q])j\{NJR+ծ?u'" ;TԢMCR)J熛i"bc 9pِjڻe?Xuܶ[eK7o ۚة-y=* 5蜟\TR8Q܋b J5MʣvM&?~Uv \*v5|ъɽḿ]_|J̃}kBYw18®4ZܗQt35kTm:X2 <ьqT֎tY+ddaA?S+KX/ żF<|´&¶2Wk0-̠! *2|#u}Czud|-]o_Hj!TU9^6(-n]c\r{T7RPvgS֋9 p@fd2KRC)UdGϔw<дл== Ws8rrIVK₧RrRhc[r ̹APfvstK4 9M1|qNmIؖ=Ԋ"UwC\FGp=6aD~?  ] qȊNP*!URؙ|DFz01w_S /@iͱJ\vr![LhY$Tb^yVb@#eC L(6UBqNPb2SHceنBVIsOV!Wxͭލz##VOйC]槣kV yT/nGj+q, C! 8(}rEwvWIsmr֒U%jZnXw TԔ'TiY>y;QLp><t:E̛sz&F&1ܵ")U2fnxoO \O%IJ9`CJ &aww>»-"Xųdub&iťi3ǿҹiy=AObu a}ߪOY~u.|.#Z#&II>R}i] z6듌|d |F2;V#ނQ$h΢2<ȫ7-[t?P[?AGAE7PkI6XUY ʈ@5qzVݾNҩ2=6r*xFsdzXmvEM].>RF  x?Ar2jq@C`wCC*{j?Q *Nڢ9;O1ꦡ LuzY]ۯ_P'o"r>Ҳ d^FN3]meGoR"FzF)0j'C9>7;Vv4ϕ>g!k:K"J @f$~CcjsHm 00iˬL d^5adpUD0ݘu F pdr?fkDZ&"Q;j&zuIugΐ"ܫZxx$RlU6R`:1aXWj6ַ6EnV݌pY71\lYV⬘P Ralc{jsDڌ KMze*A {[ S𮫡{EB8f{Gw܄nc#={/[}:;qI@~ZfO2o{ Z\TX)Q;6 ڃ?=Ր-4}gEi"=W!mWW¶>; T l4Qp: Y 8$#5bUƯЛeܿ2r;GnG4Їŧ\b=ՏIQs1M݆OWۊ`^}&خOod_ŝ-PxĎί(>6#bZ?P/Ǥ2q[)ٗC}#7Vh?6]H|y]GUe 4&i9_ݷUvOU:zRIyUԅ?)z{1=q@@џ)NNzkE%֬ S_^=|?=+őr`} J8#uD|@ew]H15ߞicn+##FYQ=Ik֎ Յ%DH"Л ߸{[kygu)0mZ'94[E7+%R vpc@Xu}*_ j[dGw-l6{נmfAuzG1?k]sBgP>*Zp.r`uzv"ƭ4Pg=n BO0i$w*F?bMe*ӍئVFVLeeo#5_ܦ0#$m1M-ۅTۧJKG6*mзVl[MڛsYRXJ5\aWk~{;Kd`R9>hEM;r5j0>!3tX-c.=֡V2rw !rG;|_vdVv:i5B<$=s[ ޹3 p]\׉$˒d kj"(.]QJEj6+*WNSYW)q}<*GaP ^jy:kkL>is8e=Tלݐ?xsa5D;c6͐~vXErq ٍ֭ &# ib94W}Ӄ4:pcW "4?SL2iw 9=p}cɏ#pkKBF 41gɩ&aʏ?z<  Uiki|F79*3Ep CN6qg~sT"aS$XFd 63wzDiN\nw>>U/"穭Pq/dM CIr$2H0G۷'[ʤ@ч mXv9D+$fI˪HB$rGU.[V 7nCצ146 <:?| OSMdM ~U.xt#7pHÑ[zNLПd|? .nP`̬ I$!OsFf揥ܘwODTq'wZ >^MLmB?R*#ں}H,"hۉѳ\ M+Nt]8؇) C4)m'>犰lǒO2?Q~e7P_{?)X-ؾHO.CN[IAfL<Ԁvy0Yϝ)~>ddB¤$ QIJ:m?ʐC%*#W5qWɂW+Qa^h˘yR$De#o$ہg99+Y?O^OCϿNnC5תŻ=¥ykJqƓOXMudpq:sP נ,qx]m[*xR2뢖?Č?Umaq@Qk^ݽW 3b#i0Z0&.W՛~?3Vwj6ju-a׫ѓffc$#=rF>f16~51D5B_LKZcoȥ5#_G 5 L FNj*ӟҢ̫ky1R'Z/YpChD=VH4R^Gt][_Τ/k%?L3R(u\u5yrÉ 1@0rʧ3S-yutlep-²Z>CYJ0A49uͦylJpELOE;Slj÷>Br7򣎄zݣ?5ˡ8EƋiSf 0ҍvO626=nW S\ɾI:#=R@>Vi\|9 Y?_s/epa.z$ś!1Ϻa7)*wZM@XZ0izC%ui|4w X~bNcOK0t k.AhɑGQN*֥\`W_"B)zWVD KvW$MVD}h5]}H\gDѨE&<+I⫖=P6e\"JO0ʵ1"cIV셧3#A7!orhΚ .*fӧD,wҮ`Fd [̻Lj دnz`xYnkl`cZ9_/F{T2pwcҫr W5,v|EDgi=6ʚA{!ݎTD@DZbwUAՕր-ϤA:mI?ATqx}Upn-5. Zז(qTVPvʘ>1Jù}g#}3S,£+=n9S<&ȭ:C4( DVnb#*q#?Ҥ[N ր4=x>Qs ڠ r7 cV2jeV'Ѳ?#Lc哦(T`ЌT71܏0QS 8O;qd?fzuuUd8gWj4f-qXž5G1k-]XeM8((\z=+1bEݞ0 sVDi&3\[/aэǦax6KcfI[NAJ_>7lc(J8< :-.Z'qz rRbe5,'kPɐ?M`XL`rAq/Sq ΚcqLEQG1E=Ne6~ ;œ8$|H}uwqܡ .+*m1Uo(*I$=9>b8(oip8V<Ra4)_ tBQ+YسS&wGMH,0c=="8 G$gJ|±nٿdlo,`E#HL쌻x Ϲ' :4U>Ԃď9RN2)2-ӟQQ,WجiZ.3ޱw,?QZ0D8 3TbJ٫ IKk@<^MId2JnGNÞ*nW|q@}V3SoR[f8yʤ.eQR↝z×u(stGɒ9m%B=Rq4az5w:9%فfHJc9$Xʒ*n "ϡ7Tęu":0 k)Xt'TĜr)ᔎ)!sf}jUdeIt;&: %b}O']$iJy+;z 'MԁڕoڶwЏ3K*o^@`'cV% +zS|%K{pT^"2O> ˚ Y!U{6KCnqUׄE!!RjXvrGbq p`IlƪW+2S1\W_:خ>d};O4:bfx<ǡ !d8FjgM&x1 )$>\)5L+jk' YyKnҁPd<Md>R mrz5u8`p=jYd~X4H>wPދG?N$IF)s hwZkE?&T$@ eVS漘~p,CtKI+9z_M$G~b+|{D:FSV-X#TKW0޹˴&[(`!nei_f҇><ñe\8SBH"RD\ ]Rc z\cj=QO[6I0} s_mOpsSVe>٧t+Tw/|ήE)ᫍYn!<S4vrЊeQ1'aԓ# TOpP3k cbXzAY'M$,IekgKdէo96PoDe'qm&de*pA Ps&Es+[< N˴K:G(eJ͈:ZM*kMB'pDw?6)c?Rz"ݜjloV+$z⮤v&Mc[C<:ڭ _ BuV[E$1,Wp|#**DSP<@X!q_z`=M-ÒV0xNF<ԀZԨHjVN0ǩ;P< Ovf֩bp[Im3ȩRLtO򟼇Y܃UyTGSԌ2;Dbs>Pr Qu2AGb=+fmpzcZ'ubZ"bj:MSć֢ϵwr= OHbT\V 3Z:CşTe4t[v㝵q fv9lm?\RnGAv"ޏִJb8ib)(!篧Zzɬ\`mY=7a$ycךxV(x 2=>0=jrc PR84YoF47YP[~]'Z>` krCq:¸ws2nG9F:'!*,otKmN@JDݜ* fYN{E:#ѱA)_1T.uqף%c3O2E(IxՌrL/\Rq,?0v8^w] 5{K%dsJqA-dzϹxXkTmA+I_pi-5co$Q0dn3ƚ!եpJK{?+'Vr$$zՈъJOjnQNՄ">5q/RQ,ENpɑqQ @aȉe rGzheu*y{1o A(ꕂGZ/X#EqVV-IIZQ,5,91DGJgpqH|Ҡ%b45GJ\1"3mr2lj`.Cʫ~Ud[gWs]\A<./ҫks\W mW9K,'v#gf'̘Ѝ?bm0:FSٞOO2nFjE{5X,z(uM4DmQl<~g]eCJR{׊E/r < FEf Tuni[#*GB L+o瞢:85!Uꔚ-_M" H[%=kН5bks%+®D&pv5uk0_&?0ttWVx=ESW\]!;o3^B2Aq]1P04G>c%ePJ@  iR6̶IHCc5a58)3$2qRCu4LƄ\qw>C|ի+KX j d l~V>Q޻#G4ِہj뎔Ww.FMJۉmG_jYeY㷑-Ƈi Xi傕@c89Ǡ&pyVJԄ8) A`N>zP:~ea<5/9OՍmj6cpRB" ȮJ +: mDr x@nkic% zq֦Hq";E},GJ+VkyC45?cNf$u5(⦊S5P,sRG&xOVB)Q5N0cxv46h*|~Wh$s0m]0©"kj%Gi0u05iwWN\vi4)@w^#Ig5!I} ӼTMr )F[(rvz.W2IqXz%쌅Hz+]bgaT#oeUH7^ĤxZ7뺶5O YGrPIa%PMbǡtKB@fa4t](^i7^k [y#q1"'@cgmJ1iqq#@P8CcF]׬W' {Dp@b2UZO{4{!YLTd"|jFvhS8UKwNc.xC2pi쌵00>6wXQ׽$ >d>.{ BzkLHpE\)>oZ+F?λu; [v>M;V2vZ؟Rc'F[k;41Gr&؇vz&`ՋI'qIԒ _ZM$29Q"O~00٤1V8>%ʜثPݜSrxlMq $+NGUq#򜯥M·4x8r)nfS(ǵBrJkS; 7rܚ2ø0/o\Į3fV<ww,(ʕE#bk0FU';9MT[seo/UG`g!(rc3CGkgi RNxǽu6q {8a^~1\޵Ke Ÿ?U*Srj©JN:NLDQ1*Go̟jgW(8u5 dD !s^?APj2I$6YI#FjM[#q"C-ws}KϪ\L©\ ՝^mjW N1K?vpQMSsNLپ@l@}H=Eq I lOu?+ҖvU`;xocT$bU9 gVX* W^FpE\gwQU"2+;ߝ'9uՕp6^D1F{r(]hNa7-J '▀9iL ]1˴a[l3&Os +s(K+UkTfݙ>;5ncu.,.Šm}1֧qsI1XѪ'+G[rЖ܏Qʍ16qkn߳Ț03֟j#fVjslUmL(sxYj,@Ђ:5k0Z, NCtI1P~sBI$cqGRy3X3]X <Is* =E>R/c0\U=Zc wQRUCcPY:Ӈ#CP Rq@W"cj:MHeI1H5֤(OqY3ෑ>*1q@kw*\3l?f_D$Lp+s} 1ʌk,2; Ve9-6O\.sT$yO2t`;g<8b$ʝ/?6]&vŃUbL3yfB6o4>IpimMHu14[h)X'niNIpҽ6ei,Ny  U]" nUqelԚ/eOpR}NrI SL}EuV%K,nR2&=ǥr΍S*^Z18WC.Q8u}*Ւ_njmsG4F%sӣF3kfo 0j="1A98A]m6r~l?zRQs7I֧ >{c&NCcY1VI"bI,Zj=Қs@S$nT '9I0{mt#ҔKS֘ *,* Qm>Ӷ`N ;'ī$jP'uk{ +PU=9k\b%,4^3ajعoŸO`n)@2WUQ'ry~60G`=O'N+| %fHbr|+1iJVeZdF`oA֟nmU|{:yh)Bl_B-c⻧5SZ/SQHȥ3-XE*3s#pҥ G#!N>̡0ؑSktކyiy>>+[jYٗH{25+ҕvr]DXαWǮZȗM1̫gbiOe V;ŕ==nY߇c, DlV`3DA ߇5Ni7mWVe=GH$dӯuܧ<#Yv+dqH5o۩PW$1/Em99܏Uėm[{vJ﷓֤Z囨0:6/0X܈.-.ܤ_<*:F~1G}l[SVh-Pg ݻ a4\,[ T daVSZJ ܌iE+Uřp!QY0*;Ȣl,L~?t{{Qt6HhpZ7X>ݩ`]g L2Uh:A^ީ˫XDHs蠟@Ϳ44> W<%?ݴrN+-$jǦqe$Ҹέ} }D<:sk ,ȩqJnY\3qOk ϻeU>S}U ZUax)qQ_l`BqГ;ǽ&HiAϡ1%!< !PpcsXշji)f}dW/_.i{ҳgZﶵ$1Sip2_cXzYfLW 8=@̲wYgX%>=iz"VQrsӿNҾ>tֽVR8 vP;55ϖʭNf3€EXKt \+W(o#ꖠN3GB9ջx. {w#yCXzE63(=rqZ- &C*|.'7I5ftrVBRGq"d~츀+5:$gE՚*x:YFpUӴ"XԻ JԇC*:S'cMҭGp2?`O_~*|+ӽ+)-; iD g~܇FW[{$YIIě]x{bX0eB䒧+Sot:jWg0n vMl w#lLI+1.MyjDfn?2*[A݈5YV2=&Bi:2NFM^ai[!]ʠS !WKB,ufVi6$}BƸ5>}~5ò;y3:G0BXv n4}*J1Fֻ ZG8u{|OUM.ӊ\ðLM-яSA(xW RjO9AS4c7=ZΏ*F~ *W#VlWD;71̎>U =CH?3ߐlk06))ʑ\ fG@GH5 :[G d9,? DRi+.?*T*c[ZkYyOڡZL#;s}+xȯ8q*sZ7sRDmQڔ1V8\oz1Es%ՎiLҹ׮cĩ;G|kbFAzeOW4tkXa22eGRSKFMge]hvx2GQVJ?:,J ?ִ[+0}*JBm{U)3LFlتoZDڀ1iۭ E׊k\@ӸXĒ[C?kaҀ13FQq*VAT-F!" jqui%aԞ#FUaƠb\T׬*V-!S)?ii&EExo<8񁖒٣:w ׷׮xb$!& ΄ּPwW6S#~WnMTg%x1fMń;2}Pӡ.X_حVcX:vk*TýiVe5&ȧZQCӮR`wviNwq4 WA_sK{%ǶR)l5(MK)×ڙ+t\>۫^ޫ,E^WP[b?B+ XבV|r=JpDN HbvQ .9.fKdYQ@F?Ҩm* Оr3WOc{}64cr|ykzYu4PKg'jJHJJ= v۱1pF$֯:C]߆4ǼgJ»rlտِ?i 5L'H.`&jm|iܩZ>, ck!QQ5+CϐzT~%cxԌg,cǛ 3 ^i쫴hXdV2nmF@2B\k\aD< rQ>88u}fk_nytr6s.$@-Ҹ_'Dom'h%`˺ #؎kyd'0ǢgǮۀ teg\#F= 5 ngPҹvع>pSa0_Y4_g/Oe&ma=k LѸU5g]@^iu88ZJV>Yt}?5~;{ytKђ 9yP-5Gl,"DʬzKA*4尺c))2,/X ThG{0qtmg?HYOj }oqG$wK}dpsF ec"X}i|%?.O\21eQ3QE?ʺD)̗ldE?:[ϕ q]>m] ۊ{:UcP.K< m\ukB18Q]in$_PU)3s,8CdU{4ᆞ>IQZ󅽸*Gq^+ h<1{ H#W!Ȫ2{9m@IK]+'3KK V?]sJ[!II )M(sV6iZSi튜mU1 S M=jOLb*lS׃WJhb0 ,Ru+kl{QLG:V@zFR+mAUA@;U{CHw]sl:uܶLKv7ʕlxgQ{ eFE"ʼI  PvPJpI*-Zٟ=EkY|Lt$<UQz'[vFGֻ%>#Oñ vRlQ,P3ӽk:쁟5&.\t˕#gqhwD~kOi 'dd="kt1p'YI(6QnJǓ\El(_cRO{,ǽW2kެj͘2T~u~b/'N.=UXtȫhlp>Y>rܳkjv=ȣ#[:e\.= /Z´3(Ktz%%vWd~uMգݶ?Qڜc) d,$_z5σtkH osYW$ߩG3Xv"-~/fS[;B͔27(\֞ބ(ևR7Z9HUA UNNd@?59&*KSP?SBR/Bu+GtyWQpr-LhOҽ.,o-ejK=aI.bDT!Y(PU׶[$BGK>hx_0XVT+bTg=H K 'Z> O{?¡g_֢rĠp`T$-GWR|MG~c*~S*|Y?M>-+ GdS4Ef?Y Sqj=0g |3'!yjUtGՇ֗Dykڔn>M7y^m{=EDo"`U?bJxЋ6iW?ZtN|&i|UL8"\ u+s6{o8{w=*|k?֫M=.Oѩ?j{I.~~/ʱk |C" WcػYQtX~gJ @5%4ij[ˋbEhF?y=c\[osD@WE;qs| +u;\J+Rރ;|1j\U#2nb Ȩ,^ & JxI(A;S=ܞ*aNhpM#y7g`ҹ}G_T#sxaV5}M#w=q\. Z¥N__Tya>FoB+Hdһimc;jp%ҧSrl {ˌ۴d{WP%mYɹN}+bEaz էWەn R=waW44JR`AMT:qERސu\MZ+JS\LP:Sހ+4bɀWxRP"Y95zY%1JTGP36ydPwȭvodѮ{u#1>S̎ #W05m9v'khN 4gx2[$fLhIctu2BGg^].QB 5vxvJj [Jܒpw[^#<ɞ%yNLn-Ǚ;QznMJtW x~ohsܫ9,Ll'uR(.I껜(>h;>1%j6`kpv9z:~5ELc=k˵;ƽgn~Pzbq*KРg[z3hiLz:ƞdV6L𪀊̶(esW`f7܊#L*=3[<%g›-i 9Ppg?#pz%]uZyduxlTdWaE=ƤTj CFM>(@{Sp3Aҁ ¬Eq ET*X1$0v #OhRjeN ?(GSpޢTO$_C/և/&:t?¹7NPt_8K~H+GG>/mSgxYn"Qjygʲy&f${jMP95ZKۙ?\HMWi J9>(³OL,{ qJc>jPșS~, |jN=jwPP)4ڰ'qHQiA▤Fܞ#cY(ciE\d.lH' W!ݴ_p ޺)3⺡%!mxqBHd7sS?w5dzi {U)A4 ێ(XZEO\SX+ZG8%emcxi>p(DUgK`GӊB[n3sv^"1dc\ֵdILc?vs[=*W E1JP5mY$9SN{917?ҩx5DěK,R~Ѝֳ5/{׺/G~qBҒ c.RaI9k8 ݩu@l nF BI`szzRzSnq6b$*qjrHޗj.wqjzuks\w<|ϥ*- 8`jKjfȚ1"`Q F^y4^0*3ORй 4} -GrLQb_zMD7pEF!9(ІAH[5at?I|xAVQOETRjte-Ԫ{ r!XRsKQV7!%Uj٪{CQ-ʎĹ(W*@YIZQҐ͏Xҗ8F~?AN JN$g_õضatfa]fA:RnñRw39 T% 0VF$p*ti Q؎@*@sګqS)㩠w.M@M<ٝ#Q\g;A$Uxќp2:5cy3vO0jPAzƶױbQVnf $󀃊bmI).7w4F ׽Vח$sEO;%Ϸz\q2%c==H 7x*]ARYb:UN#h`qM-JN,=8T ڪH[ *zf1Sϥ);= ]dQ$3l kӃD.X4#$r}*;h^@ͅ>^Tc 2b-RT͖Xʠg5X1o:W8ks%}JkvGV8 ތXj媰ÆD![t)'jp"8sRjk.(2;SϭJT#hE@[ Lz c5gi_zO+2M:cZi.#deƸKBrȬ{u#z9mģ Ӹ<-]mIa 𜑓Dqڛ9TߥH1B7}ioj0җ):Mj>i;~Ҳ7IJg<㱩^@1:J1H./՛5}#fR;5ǩv,jf'; ĨV>ţ` 꽣*6(wR)(r:JI*%\qH +7]lB= rQZXe#kF6W+N@jۈ6SU]B9ޯFAӸP)v(<џJySI>) Zf*ʚю˜~H*)-*1Wi Ytnɥz/ј*69ȧqX[N g l3vQ?ݠ ,畤Z~G4>(y+ xǃfb02͢r}jŔ;O5!&%%<5ZK9v-dF>dR?@IJ޺4,YFҫ@9E>9Wi9yCU =EP(E4ufHzT%{}T{Rb<{QTGҗ`6 pJo(Lv!3NفҐʸjzڰ!R0( zS:,P4D砩 TOL d\*cb"ښ@mEzT}㊻PMseqVvڕsUWWcV5_i\\1w 1!BqT(1b3|hs9b=@BYp9j&B~dsVYm9"c 3`sR;(@Fzҷ<ːnjDx#9i_d& n(ԏ̰OWg\.#TBm{ |Ojte4%!cy=9K)CbJmdƾR*qzƓ\c9)> 6Ҍc !eǭ09\ZLsցQAR8=)H/P"#9Lu|dbb=;SeS7nos7 @sVdc,V1QAF<3I֕3o\,g@c ҴZߜ'P1 ith3Ӛhq@6jI@<⋈1SC@ʏ03֐cZbG1p2|ms:ȷ8Z>@Y+I4o溿0E0)Hg6TUVҘ ϽwҘ~h:a5(ϖq]F씥:zc{E?MswcMSU p <쎧QsW|69^(= HkCc*SFI;ߦ*Q9e4| l`K+~#>kfx!?CIU?ZO$@{=I $GNHɦHjp\Jl44E`jDo qM3vhYW*0i X71 WJ(p: mieOaVZ!Bҹ90 6ӎYGs#3 s'|t殘c6+ͽ3ޓbHi*y9 l1ۦ\84’ #jFHV\Ac9F$OUcr$w֡km`}sh nAeRyj/0f0rGVɼ V:ɵSt/L]FcR)Di) ^URi$nFbRFXlqSƬ[˫ `0`uګHYV&DǯsJi18IXLT#1Pp^3JlxMiSr`4.I$ RoZbм)GW9ڪZC rr3aNKVl,vҚ)ItG|1[Cģ99Q 1!zU@nIIIY8ݎ=NH|_=+>HTH8ur 9<QGKkU$_ִH8Vɮ@W 3Zv¬ 2e[¯I㮆&sQzR,|*ǔ.jIX'SAjVF7i"uHG!\jBG9i0HEKҜT8&oz`3h SJf9ih !j:~Tק4! =y1臜GJK Trs@p(@ cךMSL=j3ȫ=) iOW_y`vg5GLSM:֧1@"jC}sKZ@R3ғfy8 >Qyxx=)͹JIeyU*F3zAUoDI?(*H$8XYRƉZR3|<{r,`vs%1C*6GbjGA2g+byXͅ=UUFDa:R;@cS"IsH1V9*{ÜGc]3;b,DDÿ&Ű\ܾݹysqQ<,0SiT_M4Og#wG@ܚ4KAGjj5 `Ǐ06Q[{r 5GM} )NO<O4&HǐGM %Q؍ܩ(8y ɞ4.2zAzX Oi) 0Pp㞿5b0o+c9~iL\ld.*ݓe݁ZELVSF[hݶ>n8?sT^Mja(BotkC: g8efHH;zƤ`N$sW HU^mc*a%GWKݭ[猎溡5" vJqjr8#BAǵsR "4bUFBF3ړzn0h*;P89KvN9Dd`~+#(<i6yvSHG`\sHA)9;Gۥ&:rOOҁz:LhFjly4I@XhV cPr]hR)@BpI$q֣b$Y6ۋAP2cۥI'm*pj++JI۷b&*>eۂV= oc2AL$ ѢgZζ*(HǾj齑Z$WV;c.ׁ8{k<ݰ{d֊&Jgpʲyr*,g9A}ȭ ]Wh #!GyW3k 4n՗e˶<\dK7V ޶NM!*P3Gr@N@Sv[#h9I֤ g!끚oIz qnzOL Ӏq4AK|v=@ i^y+ǭHOCi>/KM)`s@c)) l16SrTf&Zb{S#?ңNրi7g($R g4#4PæjJBx4hǵHG4> `^Jy;yLϭcHSю! f#R`2OjSGz]ޝhv;R1'֘FGNh*y=tcQy` lya܉Qޣ*;ja树s@UU=85 ֘Image1mContentsData Object 92` 2Z0`}.o4<Image1"      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./012OP6789:;<ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ JFIFJFXXC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222<P" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?9-Ϳ:xkBbzז;hMZZ+Y$ߎ>Zɧ/cu?y'ʕz֮JZElJǩcވF pAI$)`Xtz p<3*>VF)5E%dhU$גF?n yFI`ߜ׫+2\@mcXF&H# [.Ɣh(jd|j ĪBHFח~=e6nDJN>k>1M-֋)# lD똓]=.ak!2ɻ<`d7 w!;[?;R37ZK`fd_Bږ2v6"\ձm]b.m=F@G\%TZg 7@<O^G ?8} ,{Gćlc9쫚ڽ9ԗbޣ|gTӿvA}c,[I~n1N㴑em?uUI+:%`\Ʃ'VՓY&hTv9Ld`)@?o㖷PD!O9=Pզ[LmoWiFIxx{M6yfP}A>I~#H W{ψWR)ھ9GFmπ
u3gjRiY]%̬RI9ۥ4LtYtktYQ]D꫸͏ ۬ǿ<|GԵx)IV"i%DeOI4VAao'[ɷM+ tlJN}HJb@ 6PvGQ?ऊdӿZS-3r:H.~x|niRO9 Φ)ѩ Q5JQJqnNu!)*rW#)IK4M{\-';h\ڱ5`pFҜb$ᶢc?xS]BOSF}S| B\$.0 ?xZZIn(w-ưZj~s"<7^Ig.%$ɵ#I&XMck鄄,[L`^'KXDVcWqyZ'#_OpUiR,nsV־}1C(6UJ8ƛ9gmsʌiJ**sr[ށ7g_յOŸؚDMyXGeWnU̬7txKztF ( GI|CxP,qJ ,m G]$0c[]_x~XRGuTaW !ҥ:/h&\&Hg0Qyi.o-[i?4M+Rw&'FGJpc4y-18S6_:66 Dcװ1&3Q<>-_L)ź,qI"FED DnH.|1Z5*$$fZz7GDMWtEG{qF} kDTG>#C{Ս’ ǫºF 7xM'g/WlE k>+kŖ13YSVf7JCWJ6ܬ޿ k]4FGa%mkE߾?h^Qh^(՟ڦZAx{ƚ,%E-ߙ/M 9BڱEHO/xs˄×+q$iK\bSm!$h%_|-}W񭎙}^YO4"=̱?5,hܤM|oip~Ο 4Mo:rH;w5Y#R'|ર6sb3R6fm@N3 t)ӒrJ[Ǘzۙ$jIը{9F7mF]9ךֻ߳6mc+{ Pw4] {i|ᛙBm,-p(vvn?lU= Q0躦t_!$j Y< ?hoA$.XQI,/ķS,x;HHZh2EmNhK)sKm YZ{xIeku!<=xSfI+.!F[= <"[դhFK^>H잏E7lܩYmݶ=O;gIi^5u~9-ݭ^bc6{KW$Mk|7߁cKo%<3zo?K,Z5vWMϖ_:w.| +~Xu] +Kc 򮣺WvGbf?g}W':Mg^ muOiv4M@M"[qO8? sƾ[xKJ^ȂA V>(C]4P_YCpdї4/WtcL^+m |X|>b|SAM +bPgMT{X [qm3Wе{iWU{ s,9$'J ^FP瓽G/-oiE6%kZ&.չ&U. ;K_x&ݠ#*>bd2NѰA7_#~/[]kO|[vx5|G@Qm&'x^O~ {[+ѵ5~ >qne%rf3oOiW|M]cww x/&qٳwOs#Ewmq9+q4zUFørݳo'ԓiJMYON]}ho_/wSiv24 <'úƏ.kcWer-X=3˶%bE7Sk?|6:vpo~" Oͩ/"- J4Y;+vy.A7#x⦙[E/7W*׮KK>qAw{卞H姕,IH`μ!O|bƓ\i:ھ,ٛľ"~/&cF%t粗2[ͭԲ8Q6Pu1]6n6s4m=mtQd^֬*pZkeմתּ}t]j_>xOyxiwXܬ23)ԾkAl'?~_' t;ÚvD@R[Վ5kYca[m>~<~<'w&v|]Zoi6ʟs5w"no/ƕkx\uU}0'Ix ;;"`nKm>{xx+`,lRrItڳVckK}MQZJ:I蚫mŻY|+wYǚ֥'W"i|t|' PմlCp =иlZ?OEEŵ4R MCNmO=V},1[11HstM-:yw~E^x[@No?^NJ-lsos8"+ ˖Ky.m E#OY?çŚE k>'5)VVմ\yqYW Z5hz'96V*-0>[5]I>yˡƥߊ^{ϊM.÷ix?IJkv m1O2i9m$h{a4LK+/ŷ|Ij 7VI}kI,{/ Osgj"lL<3 E5⯇&"ke|'L[\:.ħ|m l/о&K?Ŀ sg x;6c^-+_K*ɡG?<& (mf/IL4 YGkg*l'y5geV"X{VE,5e^Kj[{>ExToi4Z!~+[\5V^mBlJ-Q|a[obTu -:gHl^Y-I1/dSr-R/}֭C_߆; |Gŗ~;|5xo{D]cklikqa7J:}\\!U x-|mp NXZ(/[_ {kH xi#q©o,$̽LYmZ:kv*1[b!4w :x¿_ V^) YR=2Ĉ(aaU.eݶ~㟈>5օ'-1OB[QM(,Mzj4H t/2xB<{χZ>Kw-5 Gys$MR /5;=*`T\$>cF0 ;)TIK[{^QJvFP_F̵Vٮ3OCOto28m#eOF[:{\[1q6,'j߉VXVƥc]4(tLZ$6DVZ:\H70f j_N&hz%k7ρNo^'I!%KYYf6v6?|P*|7Gs¾nOU:iz=vsZ}M-j%za0ƥ\>y+4mtp{{sZ+NXNOZx7LεgjZ}O!&9ExG˞Е$(/j_,./xk7~g}c薿fKm6r7pүZQSa,$P,^߇?)^2}㟋?W^kW[ k,F[њ+[9n-[=?hoڇûI u-.K} Q2Gm!LI(4S[]D:KiHe/RTݴw~K_+VKW-չmtMm^VU th^?_z4Cjm-i~]>?xkJ^oMqo,g"ѢTm_Iam7C񦥩k)y{ [Ӽ]H |Vyo'<\4Y|Koi DGÞ5ե]x+hV1[}m.lKywq3#_DQW𕯀W]kw7[6v$k`ᤄOn$gÿ67 c^ʛJI4.YFM鯝גQ%YmeGkrK=VM׵ 4}z..N"A$*/2[X\ȪV[ w_}Yþ/H|w-^)(lWMf&9?Q)M{GQq5ψ^e-]wľ 渎|k뫏-7L3 Ix[gf7b_ 7"רt : ­´-(ddf8|MPM7(IQ\m:.=V"i`ۣJQ-ni4鷪o.>i1jV M}fZ+#imⅸ=`D ^\4.?&M{Z?Í7 .oaDY4j3.>٥yjPp^gw/x+πSß蚃'|]{jI?5HRuW0jQX%e 7So%uy;M6Pwb^cW$-1Q~'a3':ZTQ2yoVm\EKSUTU%uʬnef퉪;X9 3B`2viL JƧ X%xe"(U0d^,6 Im),՗"h>/ ]4/U3ZvL[Xj`ښHJە>`V]6`k sB׻ʬhVOQ.k{ksOsh,QCN,fV9_Q AHܰvэ΢Hl;@#2 pbbYmiT70#hga 1w1/ g޽#HT)0_X]T6 ~ގ:vOO;'yޥღ{ib5;;3p@wn#9 yv̷d6-"nH Ŏv8wg&jf6 88r}r0OTo#r=s "o:/ gU| +7ctu 3OmSQPRFRܱ[OZo蟧[Z~֕8Qihm{zmkt_ۭ?ExmOVkb %D!m.~Xڗ,t xb_;R:ȲE-VˉbF#0,[alE]h<+?g֝@'@t; yLQ\L OΝu4p i-a$g{4-.|1gAP6\@z|n߸{ֽim]"]e4odj\->7C$v, "<`8 ?M״XFbcF ZK#B%dd_{oQnu$ tuIe7~:|ag{ E|Ja{>դT)]H2e9"eMʺ;rv".،RO%Oy&yw2ӊT$ե{4VWmFheJвjox^6B]Cus+p{{s'CŽUW'L%ohUT0+xyy2J*4 !k']@x:[7^5:eIdr'$)iw¯o#?.f|d̷~ .e.HٖQ .'iJI$۵gSfRPIϚ-Żzkk{$muGG-#VWU]{_ƾ916kv}xh0Ѱ獦tC5k#/A*uC{';^jpJ,u{jEi1c&#JS|;oxrhm`txD!4w< q;&YG6xT8xOA}OƟMkۻiOi&eDT6Rǽ Y%e^ɚy9ey*i}VxUS4FIA*b1تn*عTw,9yli|Ǖ;ڃBx9&7u">;\H9T#& #kGJ'/> ׼GI$4qZg <>d)?*ſo>]+?xDOI4GqlON4ZylNFfI? > x xßvψbkY]դ8*ÅJ|7CUMR^nvv從>?Eg.~x7EY)_YWw)s G}?g$R>{i8,T|`A'h٪x-J;X?oeScp, Tq/HiU $ 9p 'u{㝮'_:&V.L7rU^M dw}C,BUvNFܯb:T,TsQMGkK왥WS+&0 <,ӵݒvI~R[(N JxTTv3$dk}xF{O~1w+m,ú.4p7XB4xG%[ZI"->xJ;aojήpIb9 F+7@>7Oվ&Yj Q{+5񇁮naEpvS &%ݿVȐ,"?x>%x#>u3[+~tav߆X^W.[ٶ;=6?ٛ%꺃BA6 q5.twÞ$l.f^ɫ^xOŢW | $LBn`/C јQ\*^㿻ft{^>1/o<5%Ez\Ҍm'EcWw~߶WϞfjO|#oTz֗-p/5Y弲S qn߯?>+cwφ:ؗ1߁|JNc|<3<^=':3(k}m_^O-vMO0(C+* R҂0}嗿Qy~;q&;0ۆt)aT߻*15$'$nWp/~Ǟѝ|UoOh?j:NlQ%*:9[1i-K5 X*^@bŭDs$bV/,k']E-:\R\7xEQҭQx{N%[}V-uiwFŪKm8x{u|}< @VS4 -^۔[ԟkxe2־) xQV=_ö5 ),SRLרDY5LF{w2ʰthu[yڈ i:燝VP6.ʳ}.Wo-;;iud_þ&|xvk 8% "4vx i /PdZdLnQQ%I2[:77𾅠TxGƟڧuC/CKa>3LUg&k {Xm,,M;Hb٣xŸ+_$ZxOQcQƇҾ j1^xPdY3gӑ<"o x]FCw`K++W¯>#{[YVA S^>ŚDc$]mZ>eE/<ɭxZ%|6lԾmn-ls*8DPhk(h&x<nnMoX"ޢD.jr8b%%(6ir/u;jvg?NfֹKkuM:}RQOmm{IW;ʰW]$ҤN>o<7ƫ?~]_N|?b/7.6wl ŵű9mĞ{' xQ񾩡_i&Dž.`X1 $̏${ⷚ]ΫzᾇN_ ތeΓ{jxg'߻R(Y FWdp]a$c9%?bhMiԂI 5i;˛tۺm;vtV%馿gß/Jjue{ E%vxoPFGoR \"e"Y>x_j':CI<wM9";gXI %;G.𦥪]IfuKx{UPO@eZ/<~ؾ3BSZjIiZ]ZJ%y%nRi [i^V;In-Uy[8٤iϙyTh7U ik5k{ox[XΖx/3Hɱ;eX%{HcwI^ S:J9H6EE漯nQe㟅u vWφٽ$FR*нMxKNӼ/x=%S-ג3I$|'~ 5wVRōRdC0sCKlEWH-(Ag _S]΅i|9K*4?^IgX-$q-#3$cp1~xO?ľ->"t//W!Mm]5o:Y"]j=J.\iI+%fmՖq!Z.z k'_Kv>8o;x? Vҿ'} ڧOuYgͿ7ӵOz uqaB>K%ވ&v8⢞"w p,B]䔔YꖊOtGy4VEޭϕݯy՜TNƾ_|eq;^4𝿇~_:]𗎭-`F嶒\j0"O<qsxg/xv^=ůxO|1:u?X .6K,Knj[mԿψO>l|K/<:.KͧnA^ tQypEߏe=4}֚w~![f D%T7<\Asi= -$+uh?hsꌣsRv٫i>l!JT%)4ӭ]SiEBzMMM&߇=/;_w,%4-ΝOoIp#x:2ky۔ǟ|-5F[ؘ' lik'{T#"Bw07j n|Soa/x '7dwiwZlV 0I=(;cxOCS|Kچ'Hi4_e"SK)neMS4VEu(*iY%ȓ^s%+|RZ4JMJWj5tcᏊ^>մ_k^9x[Sk|$o/>jF)g, ,:^@! 5Ӯ#[kF.vl| G~u6u!׋-n|k70-|!wuw+ᥳdPK9m^hMK(T)bj{RY_KjKHڽaF4?i}FMmVZ|9oío&{|9Zyχ$^*okz7H,ddgFQKl2>$Eo_A~.GҬ/=7U] V'GW!47PK\9w[?Ѷ'ω~!u-sk Zv/s?/Qt%ilE}7r~x/i;5O:|7Kemu$Rxᶟ:_­x[jS CD2Ybj¯Rf*K[Ne=cusW% nM+I[ڥ+&?ïz, >6E5i+uKy/|j6ZF]C 53,7Vgr} |&ޓaqm,c+<`"ŧ;{_O?9 <-?ϦGׂu˫m ¾"#%ؿGsﲸkt о$ɡxSKi/wAо&jZJj6; iiEsh!P.w#NܧH_ƯxC_>ww M?,?j9c])j^ 7HܚNo{%%#g lQԄ-W 46%Qx?x_{f}:0::m"xķ/5;d4HdgksV ajF^--"۴I4֪WҺ[4}}/|@>#ZMxfXO AO u_ Nm'ZG{A]U=^;}3Qek+fԴ_4mS%oG=վ&0n[8K%Y!-> ߂$%4x7Of{l?ٌ0ݳy68 kt𭖹JO'hiWŞWw<בULWѓwpO.J.Iթ(m4WJoͽr"3ʣz7zv菦u:υǃwmGӵ6ϯxSĞ.wCWCҘ#Ԓ nmm?>X|w 힥C4]3QExI4X VC$ZDb,GE{ZM,w"żG_F]MǓP,IQ3ote@^oxL]Z6Ѵm2Ai=O[/ mG sYnnVl-*VnQ^+RI=ܭk]$pX\3T>.fׇ~ۿhO6o  j_ž{X]B[ iWtjzZ NUglm|{WzG⿈~1y qxNo."[Egj6q-Z_7ǟ>ӗA77~ּKTX5~yogq>$7{EG\~|nCCZUkGƚx@fx4<3Cs7q{d[Coזyd}Q/_ej𧋏~m+OMm ,]i,ly2%Sta௑&CTX({Spm[DWMvQ*ܳ.K0=I$$-6Һ|n/RV^H!e c;<<ټKF!LUrf$\ wJyi}-Yymk}c];ᯗD-2d,1L OUbdwԣ?h ~:q`v6>#*24-($on i-mO]259FVrv8$Sv9_|;C⿁=K[kUj_h%X k8ͨع]{[8㻲rVqMtͨ:xol•t_{knmi4O-W⫍ZN{ݵijȾa2hXdW;*>ݮ F|qy&ӵƚě;3 _g+ $oC#H@#U[?Sφ׾ ׄ|/nbn';[k?wI#jM}N`m5z) SHڿ OMO߈? |uiZ-moKKM$(ePBgW>_qn[7A(ӥ57iIJܙ[*}G QrcA-ieεo^?_%Yi|j o4Cկo47=Ķ'I\D˱3PM>-gB|#@LR_k}[ᮯ:-'GjrheŪtT/V[_H*Foc~0hǛ?ƍ%QS9u?4/쓈Z~,T~NJ-EWJ5cO <$#rJK5ZMͻݤm^7 _`sik;ۍ6wy'oAYiiT'iqt//ߴ~|dQ'uXNh> -V)",~ßa-uqʹLFI~_?#ᾓK?es]|9>Aeu/L /%kiD,`eđ 4ٶ^ci>  |9ໟ70XxI~w2^XڳXCQ",9t(aW.P 3CG 5՞e(breHy8,e۸c O>G Bt#rqb|5v񸺉)-u++Jݚ}k?Ei_|D׼!gOqmm4U\D>s& *| M_ ~4Y?{>z[,V裰mRcs!PWrxcMmg_ĿvjZWC٥$hDDbFC>?n|<u:,cygP Xy.C 1HEr[ y"\m{7t{5~Ͷm&mNg%wºiMi[ݖ$1F$ ~2[>AnI \ 1rs_4_> K?մ֍os|.Ө-%M feG dV3>[ m{V>a\ƽϬVi^91-ȒF UQݖvI=u-~+5n忻my7ե{iJҦr[SdҮ 0ǖdܑobYA u:-ߋƦtĂ})mDn #@ F,]ݹgEjk>9[qWdjm8,U<ƶsHf%zu!Y~(Hoڱ-!tveCId.e.SFqTfV0J'n?nޫw)ӵ =^$53h"}SCѲ!HRH)0K*BRhoxMK-,Ne,̓ FU@ı|j_gu\ViJ-I|H6dm@I@~_*Y zhWHt-Ֆ2pҪmb(J6J8Zr%n^TMjy;&v +s÷}WwInm^?Wе{D )&o= KIeۡ+.{{Hp ~|l[t|5Oxľ$Qg$uo?Z]Zyiڤelj6jql|^2}]S^.\MK'UhV7v RczOuɼ5-Ex[[w3g1KzX\-m\?Q;CԢRBOmY\߻?j6zzs\7a'א%9I|c͇4?|"ޥgh:ok%ѡg3Z<+e=ѦTm-ş K_rUStGdwQ± 8o~ڟR Ljke%45mLɑ!Z]r ur<8 NzjQjQgi[?_ ղfeUaӜ'NPNU5'<6O$߃? ? .|<덾)75{xxhUR(.KEZqxoao-C&X?,)yLU!ui72F-[NjЋjs+$Iʤ&bi.f IRokt;nx7>%x^}"_ h_j8Ke2 :yo8Yn#>'ϊxcxCK!5sIb<m[Ա˸sXѴ|7kI?ipj/tIV[{Yᗉ\ۘo?"~[_y|C#Ec=kbbVZVڵ 7KOaO񆃪 {sshgwP[_4W"7ь .5Fyj^$"55MO$[{pH[IY=q[ |1>|sޥ 񖅨SZ.q@՛XVԖ %7n\EnVqyא)Y-`y^M0VnKnw)$>MNls5Մw34]4\ ކ]WVUjTi*rm%Da_؇T[(j2umэvn]+_G[bѼ97JOHo-_xv WQ!y 8ndb>EY_QFf5'XR\-K@q /<1wMk:.u׉]!o +9l7oso7,s<;ۖ?_t{ B_c` {a0xzѽ)I䷉ J8D%(Mʶ7N*J.RUޭUzϣC]{-{뫷מ/+K~~::Ms>  ‘$h22;Sqe653t-χş >?ewd([DB{0K).n^a9\ɾOI:>5@\kDeohLO vmĹ %mc15f|͏ÿ Toh,.MmsAHLiqī"I%1 Wŏ:_%cNɶ:L~=N+s// 2LZTh[q%?u-GSeWxž@ll-O&${`QS|>ݮMz_'WUo[p:;s{]'!km01a0g(;ua?)`AA fMz:/M-OM-Oƞዖ+-?踹O\Gwl&};μG|mjiZoLE$چmg|oqu$Qʓ& 6/],e<_ OEx"zᦵ8P&ѯݪ5VX,V>{Pgb<+Ke/j/o:Zk\moh{7ZZAO럊e]/Ğ#}iַm3SxOֺEܧM˺mf]ׁ x[G~ ; ;G╊KxL1\=!ie{{ǚπ>*Ax?-{jN9?Yţӥ,7u1Ct迴cw$h׃4 _'%hW54k =mJo\%_ٳ\] y lAWO|Re?h /ץլCt.omgYݦudX%ſ(k-|,Ӿ ͤSX_ ?g+Ʃ$~{+,lb[;kO%Ŀ GBN|N r.Gk4XŤq+;t.ߟu-w./b+Ms5b\ϖђv%xlF C֏[+Ik{OT~9_niI{k_M6ƪ{oAM 8-m|ۛ{iZ'>,eV--S D~lan|Wzx#Ϗ_Ž;]&}rG4ƅ&[^5ʭot֍ [n,3]|Qy?gyB.j5,5w#^[+cCP{ž1w1/4y7%W?n¿ڮsw[^Eޱom,V#il2 &&^tM~.xAwgvQh4,{A\:+[ZF/`W&H.lT_ٲ]:/eGOizuυ hЍe\ZIrhn-'jsQCZ|$U[)*݌U5'vՕ/O,o,u_x6=F^tR7[+q,rJΘm:_ H(K⻨|y 5++ѵҽo3_ɧ]]ŧo,8Kzƽw)I$*WKVj˚O[jz4eV5jU]xFnWםuߕ76Go#/f|/㿆ZmďjXy`ڌ$,Ru=֡3*/ٞt4xG@ּa׾G5}6]x_ľ!-I1[G,"@ď !tfME&xWþ g-H?G{H|CN}a(4JWIQN[dVnnSK/nIv[ּͭ[_X>,Wo֏ee 𭕖Eχah x춲YY﯂ |7Ƕ*SMW/O2jfx%.[;fRπϷoŝGᾍ_ OViCutRd[Þ3t))tL}ᡮxJo:(x$7Y4ccVF2+kwa;uJ6d jViۿ"fVNr0rU_GsY;)7t}j>|GFӞ=ocNxV?T }Aoi _g6|o#_xĶ=}3Z^'ӒB,nN3lDdo)jnOu?|{|?M KOf%|i-eSY-XX҆eX~{yo޽?Γf{;+Xi>$ 7}Eu-gF|Aic O4uΩݾ:8' JPU%&}JRJZY]4en#HeE,뒺bWJQ&cbfL|77}Wto?0\ |[ྲྀjV^9Y4 _iag6Ii\nKc|kIy~xÚ\>_įVsxOČfKhmHin-HLh T ?4j g5/~4^],\xP-{[Ɗwm:I4f 9+᱑F^ړǑA&욊潝[}U<_aa<>#np'ku̕4-KRx;7ZmG7t_ k7 ouu'n|Us7-4OG=V=X : 7L Vēyr#3PᦙZM_x9ZB2ab%Vʍ,R%4qYV-]i=5^MO~ŀ͚Juwk&.[ФVv߼`?ڄ_Z4aco2 FK$!Y -8nᧅt5BJ_ ,hNRp'Zy|SG9ᑪCGi.4$x8.2HvȚA&I~߷jZ`p&6oC14ڵͬ.Nc or+' 乫С{R4o-8\ɴܷkX&x;Yhܢ䳾񗉾x ~x]xD-m{HKH?h1<=b~מE~?^Er~/cY|i-C2OH[A9 um$R%HAkI. Y~$wZGO|:'5m;Vҵ"yts]FY! t};Lį|[m1Ī55o {뉚d%k+ ;Y6^1/ܶCćQ'eg" D [+fKbpxzVRUm^ f?ۏP<}!|Q>2+ tx/n-/V}?Q (2Z }s3.C' Lg$YpyaxDij^.51i%6F@Wrن2XUWT9VQe;F-'(앥j}}wøSgn[1hZ{+^*Ҽu)Zۏ|&H$MRŴ-lQ;mƷ7PV:޷qr% *1, /.] /{?j]dN\_E_ ?D~ b+\oezd];RŠI|?xό| w><) I,sC[iڼ$^&C+ߩَ_T)PUʪQA.u:J6Wn:ct`R&ۮ[T|iχ^$~mcqVh4=IrEM 8>gcCc[wQTҟ~I-nKl+im2QN_፵Qi:+]FweH+۳rQpZ{vKK &ݍ\`7w +^"KÙ-[ki۽Oýu󷮶ocO^gω҄wRk1`vM3$W"XM"JW$+M"\w7k: i_tcOƠW b9a_]Ͽ4o*]#ſ)*Ŧcw(W)}c;s-ÚenmHݔKW*w*Jwa bh5WY(nԛGgGݥkiwOK=7c(55]l#*6 )#?K\ϤxhF6d3A[snr~S0zdc0r8VGf(%X氭Co6ӛUku]._Wn}z{}sabdITt)+pWX'|C-֑xn/h1|ke$h4 { 6E5(Y[_,w6ܯ p3EaMvk7B/vH6A!J!TEPN*F:&ByÎH;]qN:1Y[J;@?v$}t['m0Z\$# 8>Mk`8s\}i|Fvk(Ι& Ą"6c7d F mgcui*nҘC`SQX֣krRgvm4kn\v尿O0*9C * ۂH߂Icee1$ϙP[{zq^%Օl?<4jڡHdK,ߔ^XiNw/ Dh، S.EoFd6ֻcO084|;szdqT(vV7 >ÍL*KA &3\'yp ܕ<|TNaq!ޮ[oc *3`C]w%~N ]}~>VoӚH7u$LH 3qU*/mڤr4AWb<Gen)g?Y Hb] kmww^6@exyvћ>δY't~{ؤZrHɍUm(sBہ\kwA w}&8">1Gk_ &%rN,qbpe}9_h+.>xWG5^W䷹bm.[@--.{sMe Zһ/PUK4ňidZӼT\™IlTijMbQG~U.XKbus~ˤAç[('9DEvN пD?,d^)b}W@H$$l[RYxb*$tWX;'T~?V]Ut(oI#S:YFIdFf-{a1$ɺG@> Ҽ]5? \ W@4B ~!88m+T#79ğiZZ^ C>\h΍+hf/x&A{i8n$.~Wun_~+^:vx/_¯r[n.Ve/6{;l3סCbI$ԟݼo-9wZvz\~xsB5~iw F~.Ԧ@&k8ehHJ\\Chd\᷉diw/C"h%rBKq埳wP77^,𽞨DotflEݦݑ *1Ibc1ɒ1x*طUQwO]I^ګsI+i+%XK¾5+jVN-}dw}8_?6wxIN4/k._&NQk+];j> ?izx{wuMGšEV/[cw'iV]íkVz.K-Cv>Oh,\Ig-iM[$mgxxokO^:/޾.ȯmo<)ti[9Y&Qܭe3Wݧi>4kGWOմ-u|?e#(`aanFzFx^Ŧ¥S>4nm|cz>^ϴxlu3o2 Kkbַ(9aO/7ӛMs&{h,tAݺ.Njj=[J/_G|iV4ko|?<' N^un\cKmZr[FSJ֒KeL3N\|Fƭn^}Q~'uxŠ}.fh6#Ms[~<|pivvj> xWYDռ3iiga!f"kqXw<;q; > lkOmNJD7VW| sj/#[%Ѻy%du!/nwmYi-Q$]4w{?{uk$?g#Z?kk!ľ#R5# kz&[i"@O!e31|c|[oOoѴwl7P8'gfYY폇f5/.Λ2 JֵwZ/n$Pںp[ϴE.%޵^HS?DßT^׬|k?h=5-5:-/ m08[beΕh]Si-*i5v^oi|B{Zi$eZO?f~7yYxwz56j?|WxW0Hx #;\[\o_*>#|E-n|9h^"_F? ϵ_Eenn$(-Q_ iw&FWXL<-GvM4a0MB o}HJ^ѕI&Ԯ_I}q%ZuvU鴚VVZ4g)?~Z_?=WDb/n+C'l5;GOS" >lFxs^ ͮ{@&X}_XIxPf^megjM{&{eiO Xq|-KOĚG+O"KKwhj ,A Koǹ%=޿mQY>"ZkX:WTKm.-w̞_*nXtd[Jj* ;򻾺kтN9x;;J6om~"xB.=KGx"Zź^>N$D̲Iqo5зIP;"c\ CmxŶ- AT5} ⭪,Rټ'axGQL% n@j;g5gb2Ne@),(CKܫѩ&}rv˛]2ml,k[M^j%f])x{^2O~]SzW|b{{=x } m%Ķ[PE7*VU~ᕗ< g'M+:?Y?_K@70μPGsk ~wq,(t~xGD"~֣Uz- A'pΰ$Q}6e̵?xW͟¯ c~!g'bL%--$q.uoqq{*YEvVw˦Qrk[YF D[WkRQ/풷- n*isԵӾ,,~%b[仼ҵS md40;n[E3/?&KM7ۏ [j&΍$wEk 7pE$i>Wuk0\j<=]kljnsYJl`>4$š_ !tyU4G'Q'|38x:5MM:}^ >]𶕩*lNk }JX,B2_Kou^MjVޖ=4__]i![xTkXe |M|frs\˴ 0j$0|>0L[K𮃤ëK"ֿO}m`lxuҠ/FKx~{~/ΗgPxپ _~>.x+W-cO־W myskxgVn_MO,nƉ s4*K>_>?^^kkK[Vk6=ܿeOR^i.;Do5/Ľ < m^guI˟ Y< =h+9I65swg}/x+Cψ~%ǃ4>'νOY[KKeKl*Vu9i%V-^#fE+-{b0` ۟]M^^[zzYxNki 5Y5ω:w4$X}3K=n?vw<⟅/<_[glG]U{ ,,Zx'B'Aw\B:/4`N:^}e??ih_5KoOox-ާB÷hEѩ8D[;[Xձ |.k >0,|?-w7:-T՚U0#V ̌F %+9$BdYһ\׿ RT]Ƌ۽v7VvW-Dž٧7>-h:Ɵைiּcވ׼x铙mkmsr,kq/ZW]3N7~3X|C -J+kCw!ߋ r4Zũsͥ>7#[5!/Do"Ľ=Tյ4×..)y2Mqg+]YcTkM'oT]w// փvl=ݜV!U lH#9R%=:vJQUetk+ּЂks/zqwJnO~˟4^'OAsψYMksv/ k{̗)>+|?K |O+u x-ږo=uSw ! Pi&kkX.V/=ď~ӺϠhχ?]G[xX %4;]n/xJmsOV^*4pakhZU-|Я~|a}_~Ϟ/GUM4fc<3k;O4L7&G+<=l߇ <cx [W@OJHmu kvQ?VNR"a} o G'mb^)Ӽ-fNψo lXٴ!I!@(!ߕ *N[(RWFrl 5)FVI*iErf\7]s&j4<1i_ <x#1Юd 6ׇ|VÞ gsl Ѽq `}_uypx?:f隔 ÑxsqދFڃJ>i ,4ߣX\ƿˁ4R%KDOV+]I'yuI4\ܚ!N5eBG&JonOnN,18:t:M2jtQioMݻ]CEmg/:7gN~|sMRxz8a!2\Gu+K[![{u2 C ouk2fO{jڑjkL$PGQe|x_A>(D|-mi[I)bL#EUci W$C=n ⤚mwok>&u-/'uu+,. rؙ@bIGߏ]*t(OJQֆ n\]WwۆPr|E-ۻov|7l~<se[i^"sz+cBĉ If)qlo,[ʺ]!נ|B][?< DŽ/+ež-gfj> X;[GQG f|OfdRI3mMyssjZFD3ZLq47 &XO۟*}ž{x,|+Kh>n{IIrf. t_ wV ony5#CB.i]E87N-9x٩8ѯbqtiZ 7WJ35vVW N| Ux?m/oox{O^6<=ݷgsi} 1ĿW2W\hi~ÿV3ikM>*|o-;WğOZ=߄< h$mu iri5kN4&;K,7_/=34 rELWiH.4tA~׏d׾4kOk=iP*̑y,\tx|l߂zo÷W!'V Xb_5<7gsK%g%}:0{yMkFkZoҾ n.#j#^@7]H1&ω |YOsm}O 4]ZaYOlz6\J5H*`IUr/ZV'<7}e=Z] _532Φ(ekS]imYLx}bYz¦e++$N&}^U1YAMBӯw /r/3Kҙ.7wkk&{u1ΞJO"4-?hHx^~+jI 6[=,H&WvrBLJ:_]>ea^+iw\yVq|=4l5H\TrAH]d3lfv峖*}Uݨ;jգGl}~<[>h %4ڞi).`֧-uhkIs?y|x-?o~~Ԟ|gVt.|54muHݑxg 7Ep-1o\\#8#o ş]⯇6="n 4 4> tei!յK)&k;+%>~N.x /14|a>2PYm+5bxj>h.'Υ])K;3<;KT%9ltgowz~$Zi7cRKxvq+"[2>,nt+ݎ!E}c 2vVK} WZ&}|Y<g|Q+OH}xϏ6yGBGnڙv~cWuT`UG7}*"['-+f۲`:_@|R>|IoK6>#o7F[]P*`v¶ nyX@8l* 㱪fIVO@'8 ?N(NC^˦2خ7H@$`%e%, \\\`a7A`@BzG?֩'-ay8F'uiZQi{s;O-odv0#Mp8nA+ ̀!ܵt\P #`_,W [!H$sZfV`|]rC N\u}XImwې% i*6iwKwФ7l%uoŭCP+ d$V\e`54Qƀ·A]܀2`y#U˗Wkv 0S1Gڍk 1w9d2&Q~v SN@mǟ[:䏙C'5jdnj\0`` `s\4eVWɮdm_#ziwd[~S߃/}-~_+[Bd=ݤU;U( ܯ#jf]pC*Վր=܌Ip- ʮ\`k'87JVN|ӼeM_K5[ BmݜRml-?Lg?o]ώt|65ohW˭Fx]-,Ϳ}vYX-Aa࿌%sӵi!y|G?f3s C%ܥs~O.cE5dnZcw|3kxV׋u2Ğ"h㲾_e{;\O m䰬sf -zxM>oj y ] . 밴Ai-EBٴ9M_=֝{kvi.x< jHwGBk={_~Ҿ+x ~ϢVh?|)x Z(K]Myq1 <Q|Dlto[Z[[De^Mխ<'+JЮ-լ6Q{$y=m;}o _'í[Qt/tUĶ~Rx~ N;E#P$L).Gl>3z- [N>[4LG7 0xyvg9 _=s^UudE᭮~nȮݯdp8>]Km}me}WZf;oݶoEu k[5o ^5< lťﱩGú|45:E5j~3,K?x;[U/i,i-y)n_=x#Đ":\+x>e򣽾_)h/t_;[v+ vh?JS];9@o W <=I^J:Z蛽~K6;c?]iᒴggtԓUv[|߫I{/{Ew:晧>u5čnG M^G]\,д3D̑[Cv4D5OkE{-$c7]3xWĭ|LҼ+xm%vֿWqpKs똴ms++Sq3.U>/!i5t;$xHLW1BH?jR\JIJ6Sƭc_ƣMrMxVnwVIXgwtW)SvZVUp*9zphM-6p|Z7ٻ-_2>x_33isLWbo÷Go7K$Lg\A$->d.CÏ:5IG߈bJ$xV6*h[j/sa$))~+CO؃Ὴ^y <^{8$,.I+ R#2 F=/S<UH]WN5)5{ÿ́2*B%‚HϩL+t>^fxhF.-*SMY&8̎N [FFJJUF)R.Ҕ_)M6椖IYW`qThy4vj<nklÿkeyc>ah 5፯c%"ر厢!cğ7i_n0ϲ ېy/ hqDA0%GƿXkWV=o-If|MoX}w<\5J`jC4ڐI 7pVfCKF"T2 ؞+񧋠$|>ӵjR^+fo $Vr0l FC!Ek~g}_iV!8UիdUKe-ZcaAQ)!RJTom&ihD^?t"OºDus|=/r[`9.eWRigr3k/[xgxZW}@y.jYƭ=p$[Fh^м-vtմ/XssDeu1G&.$5Z^7nsX./q50P:$2Fz&vp5Zjub'7i 8+˛MG^{NE+٤ݓZ?Uw+.u_jO0yOH煚Kb ?j/Rf&i$e5yZZhyscD#htƣyJעed-džC"s0.Q4 UmƦ⅂ż}25Hd}-c$1x|l<*t-}\ՒץnʻIvo3eXlFw+2%,xꭢ|@y]{}o>3jY>q<]eq29p~M٦oxS:-7/|Oa6^bEmz,IM,;_OGc}?jeidi_>Xӕolɑ2ɾ(1 m+]涾8][OwXh_Go]*`8>f2K36e̹\"4kvzC—ڶ4+o*x9V1"H綿[r@m늕eZr]GvճJtݵ5&z-Zծ_?jG싧~ ?ggU=ú7ŭ Ɍ~$]-l~\մuoujt[Q?:oBռ'|moxQ_I7jf5 .-bAG8񗁵OxN -OW:Zvo>5kk{cJ ~x3!KվLx Əox-:U>0@K$Btr(-4MSJ,_CO y':NQ86\-s7(6?eb2,rtBOc^iB.5QJR!;tKᱪ˲OfKe֭YلIU\Ɠk+]VkOg1<|0 #U$S_k|M?jO lZ|O5.E 1/Z}5"|#%Dke;w;4x[nO|r%qy3Om2A綛寑bBJHzuQ=P$qw_K5&&BT&2/YEo[RuK5%|6hx/!rGd.b׮,ŦmJeOܚKbFFYQA46PpϽ$~:%lS1m.#FXHդǟ*B7*+sėJueԖOH!EHE3vճXZV;y$nV\m/#ʯooNsxwU-+V:f eg mcOD@ v71EV,t5i-_xxI" /$j3 wdǑ­O7W]TxMx;|I4cDQU.ak3[Y׃tmCIa{ R& ,H`-t;D$q[yb|ndIo߶,Kuk<[CH/Ih>, &+/)xJVaf4R(<=ueM)YMM<ՠdh\FY|Hkb?i:S[)v-3>YA6%o.;+Hgh.ٔ,AS _(:[5jzݽ׈tB^}?T7t;Ozi?ڡѤYJ.arTozj.huW=Zhg=z[rƵ<>ah xÚ6pM1)(K3o[2A#mDBdK޽$1^X5 Υ-Єj%$yef n |Sq~6iz|Y.>>h)u=G !ׁLr 彘Y"겯G͠xf|Mf-̰7Y^]z[ybPl'&˖XX\!@tWrq\|:=QzQsZRm Rִ=jT*jl愶Z+-4vG_7wgw~8>";Gu.t"I#E|Zxi6g}V[BhTMnK,CA=Ljl.MW81Oұ]OGCHQCHUQ2ЛOա^`{?]iR]!Ӓ6 e71^3x3#B%W?8['j_6x73w-cPBӪ2]dLF2Po3@ɮOPI&Vv+c/"†$QP$jjs02GM>ob+g'KN+RN-LF1\/3O.?ʾ'Z'4>''%Nw݆1/Z+3}~>$H7ۀp.à$cW|RC[⯶ǔ_mb8@$m~Pz7.nU.x0 mb=v6P- QHz2Fx, _ Ioy6޷BpmY5,_E_}tV]C|~ yc|Gt4dܱ$ IA-u80x2pAPy5jƞ)#[ah1Cri0Q8bD#ޣ{ >1s7/CmA+Vr,fyp1Vݑ2Z<9mԒo^|ݓ3mYKXvnѴ(0VO<%d/l,K(*wKm, 2`l/l2R,ڶӟ^ڤbsr{lѥQi]Z=6haC<~Z֓W\Bu[?1tw9dYc ZW?e//QkwZ.53St 4MDTmJ󭹈J2++ZɷM6\ߍWV=9% ;fէk˕Q'NxW-gd|k5.p ӎsEG[#HͶ2 fo,'7 m M+shi̳!|Amw>ΰP!wť 1;t_? ]dGI+iz3_w%ԌQa# #N( !ā[y=hVZ7;.rNdzr?➎z]-.[ Gt~"hv7mWD< iXϻűEŰ{yZE"1Mj%H. x=[ه-J7Ok [i tmRm[FdIय़_kO?_ï [ui3j^_~x[*%f2D@ {S/:̌m.|(W(I\+Fw"7~" R>)e^" 9żlb]sꆟZ'*"̎ ̉bf0~۾/|3]*is?\\Ŏ˹hd4d?ktd-OQ7yDB2% `ۡ$pl7 7^km.yAF%gu$6q#nhܦ˂3;_vuw庻{+mxWV%Y^KkGUkj#~!~7hO.ʑXNc*/*EOțm'-)OZo4/WDm Z_څ|Agk:J2ȡUDf8rV/ lFϘa?O Lck!t.|LB%&hv\l1',My_ZJFBәifY~]-d{G^VG]V05&_ $33/8]xjMѣVjs.#;rjŢx~ orSd)ܳ$"H$Tl;7-,|MC,M]$]xouAHRm)*Yb3/Ov{kEW# }f~ѫkev^|Sm8"O ٤$b(bI_ YD=crI,G{LqQPctGQod"y5VlFhe1鹣WA(4¹ikhPGMƯþi$Z8:/f67bpoΊxK:i0^:UU7r<̳D#Xyq)M,2a}Uok-ok/ěcQfN%X|m0i.f:u.KO2!RMp̑,,|5XR=yWs؀%iތ%H'OOWeIZɽ[n_u x5h5~xoQІ-J@vo$,m.-[c*3<e.7|?sĭIISl%$9ʏ w{{Zzu݆Tٓ<B8W)AڄꈣJ-bZqk,?|5X"uohA"YhpІG1~ս`SJ饛miíYnO5,?>oRIWpiZBS^$[mpaGd8Dq<40TS7זh(6]L$$Q!*Yd.3]7gMWþ"ֹglKG8XdEhݑh`D+5v\EgڤbhYM{{7y]/wmfχ:Y5=o^6CY[їXm*p%sy ڳF6T?kE5mQX]ϩ?)2n_xA&)봵+ h^;XVx`7/!麎m6/ MiJ9H>Б&Eyb1Jre…:x:VirUuӣך+`3'Q[vv},XtrH|9r࿉^ } Ctc(c# c 2y$+d5'gsxJt}#_de$>U.}bdX\]BM>U|m/\x0k:2[X"O[Yx u>*cclfXϞ!bT3(IfDc tLI;Ikkť&I&wI+]?TG7]^vӺ{z9"~(g}K'?kz.5nkڟm^;]J s}lp)Di~Hg@KxFRm2k!K_˥ꭨxFz֋rkcYޡgε~ޯ/zssx)c /vYmLA- d#|C>=XZ^_O |Cе[=K^huݵֽUޟn,4c;PsgoXOZxs:NJDNt-pDOsYZ&Q/3 饇??7Z~)D>"*M}i "oSe~kixI4\CiڏY/xw-fCy)I-巆!UbܽØm}aw6/j\jVnD+Ƶeo,sIhVĭ? Y$XC Ko?2k>fiMKZ f71>У'?7f5?}/Kczߎ<}h8yK;ȉ0Ά8$ *y{Wn׷iY$z|'tQOVI|*Zww[]{ò\x'^MƝ)g<=ɻd\4a.F(hd#T_7|+Z_xEbԞ:Ι4G [X&kŚSIpRFhE$d? Ŀ ...<;O JwM?9ĒJBNʁԲ?U|8 )l~ΟFc;K^EMVn_dg;oD$5قɱ*RU}JJݴm=Z]1[7JN[k5BQl  >:Vn4uۭm[^q-M q]= jgEAg/-|Ku-nķ02~#m.;]L!kbr_iqd^%| LF+BR.]}j-k3 ry+gWF)]\#JZ8VVTm\\fO\燯aePҾ Fbo#v*V6L{\, 6Hb28'q<>ecss^kShڭ+{U]}'_Xjsk}m[kπ_􋫧w[R&;ai"pq2 QJT3'>ߵ_M˂W5Vi_˗y@#6Y_c^]ۓc#FHd x6Bc:.v[|C9j#”A@@QOڪ_ ]n=F*i> ZvIl>+oy-׆jGU}̩bFI1P6* *=?6}OnŃk?Հ{[\+<؂\EdAprxbm#Lh% resd O>'efVfTv&v{v>҃i}O dۏmvƟQnAHF7%3*]_oϥՐ}[_YGt=ѩ Qf/h 3`]F4Ae6vsGkX~$^P#I w2 2b#wzglm~ ^d0Am!CrCܶi=x,Zo T9u8Pxa@+jtQy$2M&֗$Z+&%ljOH4,j8!9PA%T] ӵnBo߆: H>|H=YivmyNi4Zi.Q~1: |Pd{q*3>Wk+5t>@65)^e#SP7!dfGw\7GIF۾ӺI$MrUº7VZQ:_\2߉<MC~bC;Мmw"\;*Knd/P"]L񭾗t+aW4"0aBIQ?viCrZlDqniRZ$cCW ܚ:m厚ESwU~ )XmtMo̽;uo%m[]^ž7 ڮf"Ʊ${j^J_i23-ݞe"򼉻98HXkxݨl#Mhhೆ(W9kMXxgU:P NdcxysX\kt[L}=t_Tg齼G ;.2I%  mc1 x%ڽŌI-T8 EssO3-,Cv[~ԝmw<;ರ•@vO Ƹ߅/$G! 2!|6. 2AŒ1%KWq>{r5_>(b]_ܷMKmzxl5o 2 Pz9$ܰW6?4ȩ.o1Xӵ _*@L30f2*ipk7z2V , ;,QDT4,SieK]RF56IF2FH|M˓!YK#1+זѭ4^Nɽ6EJ"NOۿyvѦj+wOJL=owg}ӽK~]O_#-{:qFrƹΪQRkV Y7} d3[HCF&xxX߻L;jѼ'Zo3Tb_˴) d,aJ0 oM6TD}$w#2 Ɇٟ,$20gdU?!59oz8O4ZzI7}^ZK+F4ӧ=WPеK/zhˣk2mСyY5oŒKe$/Oax(QǥifIliD1ȉ,#,U>RgV6:t6[R4&}SF/ɢ(E",>P}Q]SVבT-Fdi#a,Yf[rWJ蹬i][Zͫ6갡Kui/7[_{[׳G |24vO^ΨcҴ|4: (|f,q _1 6OKu_ xCqs*^sO i$[dwIF8! |8o@UtGy!TS¾ԭW+|cxOUik[b CcfY|d 28+ixTaolo6dq>?>ĖQ ;s3ŶˠɮC4r JKMs+;"޻j]En߇]tImm?zGPҵYgXüB%txYY\QR FsKСԴsRH5uGSL* hTX)?ĺB67Kw\,Bo+HTH-4p8z$mvkWFۨxb(e{58$hm/M iI̙2`088XePhUܣt;}b[:EeoQk״~kD:6̑a!%ct & <+S:9x@XMoB1ܟ geg$ k*|C?Vtbox'|ڱA*I-II,o#loΏu= 4{A6ouuַB!H'EԬ̭ Eʴ;b? kEԅtmTRI725ZԠEy+A+7؈׾/hzߋ<~o ٧3(KVEܵEn x5x#v7vi~!00$-LIIHZk-xÏ (xŖbk*|5#1ԖSii:|3:_†gOHgen2 Ы,8ӒwvVvViI>b1ٹڭuW=_ om5GR}W+{O jtZLS-͜=jcd)iC) /#|Uu}bLo.𥬱Mm{ ,S,$Fh:<};mFF6͠xw Xya^ GN۰!w;^1Lj|N|Gkkc)h4o>".$K/bD6lHee @/J*{[I-;y+WܘK[ۺIY{>E}|k3gڽֵh^k.k(xo$YaAhHEhD h>Kk~dHp$crbV8dL0R 5&<9˙Klii^7$HɬȚu |FȌ1r#%YpIzU $I=WkK^]{ Njo>[6wqq(ѣy [Bh  =|_ jZvk$񍈆 h) .WhM%o*C,uA?v7T\ѣW\NAX \|=A垧xsm&YhV&5ffd DJ$,=T{=k]ҶU#WpkE{_UuvZHռ=jztOTzTAq ¾2B!BGxhcq='e'^ b/hZ>iv 8,t@ R./ +[2pm^}]ڻ-ͧM 5}N]LC}iϡ[ؑPq)K0S6g:FmÚ<yk>k=ލ~+iD¶g^Clj. ^X&Q2 2 k]4#0U{Z%m-uZ+e{hg`rV֙|?Xne{SħӯK+V|A?ϥj:T鱯4C?2\3JJ !h|*J?Oڗu[x[ƷP\X63Q¾`yll\|D^-ᆩj^'5 ھ=Q25'[K2f,{¯}i ^/mKX5|#/Fg֢pEIa ͬSopz(W g$䟴wK:bE*xjJ+V]A_KIT\֧j ."vsxƞ -O'-x'Y-'a|lXũxëH!tM?\_A)u1%6Bd>wHǞY"9!h˨i2,-G_³/c%[ ƅ)I-M;ZzXLUt]^[#iO}JK JM{.޿[Db9*L/nuy Mo2F q1A#)P/r!E+ M-{:%=<&[ø{ ܓ:otiE]%}Q~*SYkzUΥ}2+ vsYo[՜kg][\\ĭm e@ [Jdw:~fW;Z߁P6g\߂f/ٲRӡ WM}S5%o;gʽb`]# 3|u|m5>~Kk{/zȯ;is>uLg*x:dZ_ݯ?h_ |vcڇ h#EѵkD+3P@K"4i^,X[!ް%ދJye޳~.alFe{:o ԓȞJ[=W_G+V'|N~5ݏFr-τHk5:o^ύBwM0Vm˲Z$N49 *]gYf&lʄ1B\kmYfմ˭7{m7 s: ԭbkY⿎Xhj;yM5ep0AlE' v)7(]FN|VIQqi4 9#h*i/=3fQ,U9TZ.qa4Bu+k)m.7PۑHv ’;îXGg},&Fx r 䁖/TF~EiDZ(dQ#)< BwyʹVmA~lejo=[r[jbbI%1 EL"܌A"]ֺ]zn^孿~JѮ]gZik׼SZ!o jLވdgn%pyK/ B>-r&C.N(Ven8 H&Gj_?= jSGxV&q bE >cd>YwH;Wd:ÿ\:"CM$ۙ]a̰,hS!?gwӷ_PY'}4׷F}B~FIlR\G9R pve X/ 1"ùIO@5Ɵ2Sy5x*PeD RT $ _߳>zƹ|AԵ&1-ttM}IYϚc (i#LtWMJ ^_oӮ!= Onr 6AI $0OK'naIgNFsp2+uټCGz#EiM7:Z TIUW񂅈3|ocoA?Ь/v@hkƒgmoVV‘Y}fWUKٮ(o-&՟3z;qk5%mPG`8[Fc6#Ag8Ú帿ڽ,l2T8R8ۭ]ĢxI}{Et_: zYLA])ۃ8du$=#70v8bv88jq?Ke?32ʬH;@< 3 2~ӕ\& UU>k C1~kMuCTk^2nך׈O$y08S%vFҠZKxآ,U1 " 8b Hr_6?tOI Onvv^0 8ơ8Tgw=Z| |16VM ;HY@eI$dʯdݮ_]ЮUt\Dw:Ń n9/ i4Y=Kܐ@!dX_튢)`y#߻du;·D>$^߃|-../ӳ-4.zaPm1q$l?6\ex]U9Ms%hǖ/g[Z7Z$oT}i'DӾ9+.ip1NS 3'2m I&T;j6A"9nY'tQH6'ֽƛ#Mg'ּ7Զxj?-W"xbd,[e4cǚ/"x*OxZ #E3[-ū%w󵼑n,C"vZj{>d|E{K쌽{+_m{뵷?go=«9|̅tmp\n¤]XZiq]9E;G`fI'7@ 2lմe '_Oٸz6T) *n3\^EkWmmmwJ܎jە[=t~7v\Ӵ mpI'N{+n,;PSN\d\ɴuiLrzySO #' #:V̀:=3:$`s/Ry&]NwSbEm' u?z.mcNH>OA[Bԏ^fx2/r{SFR-䷡9sfgr:f" zmfN$o1U1OZ@lrA;]y?e q)9W<qJĸMI g-ӷQ׮z=C[~7<hwYi+P3fVTV$ߵ(f)OI!O-"0-X1hx$8jiMֽ~ZZ:7u{iͬάڍH<"%Ln3*$* pz䣎(sQh^2y >#+6˴,ZuhIJϥh&KNcjM?|$cȯ ' FbHxbf%MB;;:UWBMqo<˕gKrG2_G`y褚GU~vӓ^on,'c4MgFktfw_+]ᢚxvsmҽB֗WqZF.AMQBL sYTR2xm-[}3ͩĖIm\hFiho.Vh\4)+ $֬χ>·W%(BJI9(Ӿ'*k6fj׻0~ 67~ d7$l##eb|VBT^ {XxR4Dr5.TdW,] ^Ig:vֱY,xZQ%m"lj[Lй5thq'Ե Q5֩麆͢%abJSo.  0k:)i[OMvO[^/ |N퇅φtoȲhMȨ]~Dpp˳ V|kc/[ӵ9#յXX4q7xD]$aаtxL+ e~UcK\] gKCj: i-n]̃ NǞ?>~pލMO% BDi:2XGgɃWzׅ o0Ñ|.,X'Xc=>i])ZiuZ[ym|hJ׷$7|E͡CmF~[(ͭcMv"ڵ3I3^62AjIun<7]7B5"RB<.cth#;Kt)ȁU呹 |Lw,4S_>#5uc>,<yHOOqhۖy%1DƵoxcLwf|NPyufK_O Ԥv;bTdKq)+[}{˫t]' x2zU#]:;KgK.ؕi|k|;_H|-%7|D$ u%vY^[ۙQSM_Vku/G񏇵gbK8dź7'IȐl9e`TZj&h5/˔>/>[[jZxd͞Ƶ|KxO^/[)ttn$ܡdƮY&S6Vߟ6KfkZvϩ|cm|K|>uOja]bd B6"%ŽJMډyjC>/K^1qݮKq|8.$qϵOkNo C1XLWM,w6oLjfk-W0>#Ƈo;xqqD8mo35;:r<IH,H־' M?)ĴU 7YfJwlU?ne[sJ.t`gۺi+(Y;$ӵoi?uos4~.[{X5}+R"@Pŵ!HWdx*y+^0gxGzu|1cEr(ܥt?۟5I.F=:ڧ7ёC$(<ȣ1bdRBĵVp~"x#bqqwz'AK3 #We_gb2aj{[Zwb^wvL֎çf&J\]y]4ҳIklϸ7V4Oxg~7G_|/񳾭5CCC\^R;Orl(O]z?4MOWmsO5_\c{&8̧rv>xpwaoJ'449Ş?UB]xrhf9bRGRO LY:e.q=x:Sǻ O x)OC|627jΦZݵʺ%ۗz\YC]3}u a 8!A-$nʨ⟌ nt{ kkWnZy i!*ZXT;߇[Cuh?9xBiDª̈oeZg*V]>"XxWn>|$#^oN❞ܶ}wK'k}]dnKό>-;}zwm[ֲ/CaW[-gGj匋v=k89h\:oi/5+u,4Kn4<6"d,W?$/jGQccGEf=2@E Z'bV) 7~lV# -]H^kwe,(W0)b0Qx 8a3:PJTM%)JpR{$QrJpUҡ6* 0)O>KִF3/5]ML57|5C학#`3sT .ߐ5 *rVw\IGkW~.esv[|6+Җt_r>0/d'|Muӆ`Ykzmlm[)@I+JFҹ+MCX}W ڴqϬj?n5ex<6GlBY.<*UgR~zA+5spR2e.|2 [~ԟIju_~۵=SI@!F7U` c4ct wou}fһqPWZu8ラ=7Ѥp,bqXuv뷞5WaĚݣPn%мi6[;2BѬCH2[ :g xUmAgĉdI!&T $1ؔ_3ߴ;Gůjd?ڥrCIŲ>h988iH~K߄\ޯtt`'lh6Iw6vH}?µy r?vm[}N q im*վmvdv~ˬx{~VA4ThZ>!Ǐ29a@#Hh iw?jh2^?B<ݰtTl )Qxk5cŭ4|OE/I6ݝ{z;m'XX$> vIk$x#ٳv_'Lhڿ-<*O`XMU$;Bzjgƞߋbd}/W-Fu ̏¾FC(P(ׅoem-A[{jݒ`K/|b7m&Xߺ9 Lc8Sa|!2R'8'j~r|Ouχ>h"}]=WM׭f ,3ZX4[^+JK$KϏ߶5mn!<7=Bf'dSu,r0Ulpr' pFm=7wʭC'{]uIhwIUx);Y;m;ݕZoc&ʓ: UWP Uz2r]'>&!l/v6v3xHb?\Is vM tV[iQ%sAqi{omHe)42uPN/Oc"-6/ A5 ^9V)eD(zt??-k|*P p.m eYdL+Լ=5gPQSu*7oD68X^TRqY_j 62QJYZx~6_~MG ~4>8omjKׁMْ6/',[ ?PT_ h~I)7/zO/m.UxGӬ>I O{ocxU`ҢH{XL|n>mԭ5ו{YfTwn`_G xPӮ[~"ZڂjvS:$YJB;JN 5x-&/NqtgJrqRvWhTSՏ'OD]2Y[|džb*p{DW/ĿR/maW ƾwd5H&q!5U߂?୺vѧR9/hUZ)g$,, [EM?X_z6w2?e2t}B 䱤-?|;3KbwTOqpRNPI].X/h}+ºq]JR{BrISvI1hHGď|$A v6_x\-QfdDR&AFWSxm_>1>%E?&AUi.> T jADgk};_!E^_7v\ZuiX!y~-݄Ps_f.W|K|SE۫O,| o6nZh ^[=PiMm$v]y}4x#(ɎgʹC/"Ho0v^zj2iNUiE?i)Tr5'r8`TcgtCzʢprE]W dntGBKk6?iQ~w[aт1p2!/ Ye/kLMEnPh ApJ!_=3y&>?hkRJ7ˇ͌uY.^5{HYđ ׭e:rzR1K]g)idR;pEVU+JI`EtMʛhjEYFF* ;UP<>+ M΢.m(4۳پ0 ?dze|{d$2r1f5q/%ΓOķqnt)bRNM|+j ğ+3~Ed P2ǔ ŕW&@j~VF7߈P Dʮcyù4W&v˚QvrkD˫ZDէVIm_jzv4wf-GMH̨T ,x犮"^2{H$vE3 ,gHmv> ܤ0_0ˇulJY|p}/ee_qaYK0K\AS)FTtU,k[Hۖ)/5Ie{>+ƫi[nMm4OT'^$$m3H9,>&YT_|4/mP6Ke r jdGVdyoNڏHPt&8䍠!KI1%f؈ŀY617g|Gz5,0BDDG=Yk5 =j3i$w%dylJ]]Z׺OWtnޝ?M~4I]mGg½4[Me"ͻ7ՊF; ?BO ~.ot>ZȪwRN؝΂F;d"=/)`5J]?^$ӣ#ןO "$ŚMVIeqtY,Go3I?ذe^(}K6_-3Y|y"ϛ{ODN~^rjg]Wf2}e=yUԭ.mX]v@8$ .m >^91xFjq} 56`c98bMP٩饯/]vI_emDj>'rjzWb9U &vN6`f$^w&U' '9u-%'X%r6 pk[%HO1Ԟ`~`;.'藒kEM4_vg翗> QiٌX}R F]{`+›B-/4^6{~\y `]͖̫ky̐p7#y to |;ᶰRpf;2w'tKN\?m{.m [NˣCڪF2xF8<#ie-K|>23'<jg:kE YNLpC$֙'OomowKk.g tM:n DǼ"bG Bƾ[+/[1]βF\,GiK}J:i~%$R7F c-QȤGäW g⎡|MYZWNW[9DRxJ8 =uʍ[X1"\G |P~lWV[u?X~$&5ˈ"B'fmBXuY ҐrL't>M3ӭME`=$`Ğ$)]_wivHt]J^F@Uie\qBN_i>#⳾V(I %U9Y4WM9vZhK[Cy~?Aŗ>fXm?}g{b(,Ğ|Ҳ[4D7W7%d04>|=1x[XԣDo-=¤SMy$KQ9@v!3x>q!<'] w fG@ ̓[ՂuscsxSK@- W4 ,oJmME,J[m-vs3oSe/"a5tV nb. >^;H#bV1:$xlluQc^dE*hi ɗzFcE Y^BƝ :λ]b D}cb2"hYc[(h5-{ZYXJҴGDrx98>vC!Ƹ$Rwʕ9+׳WKg~ƿ͛[|Gh7o x oSL5 h|B%8KopLw#GjuImvtr}H5š꺆6"iH7[B]=9[ <ϫj? OR[4jr]|8׵m -6p6ޓOAG}Gm-z¯mZOxpN[ [vho$yb^[ᕯu}WLjrxߌ|9q6 4bZ 1VxlZyY;6t0Iab;f▭{oTZWz{_o螖ޫӣz+$nBៈU[?j:}m%ָ~jdxEO3$rA2#|GL>" mGBt Y`Mg>2~9-SJ=Mś}Y,[\C<͟<_⫋ |U{>agܞ!ԭHYhI[ρ]xJnͪ8E-!d1:`C%LyQ\=)J5凕NXnU-dkFtHЧWPTwk[]tSIbEVlʔ0S g.fٔcA p y9`kWx<|B&K!ut5!]kX./&Gϕ.+FYjnoabA cFI =k\c_z^)kq~^VPIN4;{~/Ƶm6YFקԣpH4O2GF=5! hmxz0G,l\N r8}C@ЮXބ:CJŀ8 ӓrY! P60pFYRH}hοYg+8㿻uQ,i5[Y|k˷zJk,I9;N68/w a,iU\UrA.rx88ύ,AuLڣ,k&@r ^o{Ef v3+{ے{TVU[×]?-i`(ʖEk]>A=`1&NT͂9T֭ioN4krpÑ)92|k6kmI`Fヴ0J'&1PHKebrugĚͤkwtʑƘ\m_UA+2d(gk5e.WRTff? ,C^W- 'zz2tfG!;okY=9lۤ*6`΃~w]A*X9$~B⤮Tc T88bsP5W눚[]IJ)5 6i]{5k^-VN-gK1lGOsTc#)!?a(e[ӿlvo=xUKr~0XH8ǷckYEbTr2pN:Gj'-d>!'(9 8 _ j˭jڦДtXj)]5hN5eߣn)dsc07#'&O'nCl?a%zr0rWhhs֠~-:Ͼ;jIfs6Զ[?#W`Yq@%O^?jv`z0”0<{']ioMt_Zoma&ۤZ<;onɧkfTI~n> n`w3ð<ヸkj|\Cr7\`7~&#qٜJ>uji$[$w#`S3-w|ҥܕe<  =qx7/X(XI[pk\`UpvNkT?D'N~ F /fHCA(:yIm_6n.560x)UP9lvl;庻߭lD)b˱Ye, V)nֺm'쨨$!|̑:2n?ۻYg&0x<K@<0>d7zovEPF2;?(C>ou*J 6T0[Rk zYۧnKVVvGK`ݿ2˛֯h}Rfۏ 6זr2?f/rpg䃂Ox:2~;k#MaT'4l"nWXv9,5oKrN `: rF]k[,]\j5&TsT6۶rH8sJ-q;JiSeOVjtfV_RUYuMig}]OCdu@E<Ʊ2L)!? p> Msn~ 1x>u HGoM4X G>Z=i,TRp@RĀv*3N0[`K&$b0kEY3%d쒺nZC ^YvJVqy[m_?P(;t(dғ2H*!*ȸ#iE%x/;\ne-R0 / xB5f`u+Mg\2+Oˆ񅍵ˑApI;Uadr8’9*|geޣ m@Sϋ敩VQr\fBl$M8œc%i9s-q,n0GhӊYozv+O GC[Fx?؟ ft[]r]@5K,Y^Du&<-$Yn~k[TH[Qƛ?#XV5H%Ѐ ,c,QbH?2+YxKF ӌ)e 0W¨bq(IrƦ_γJ\fIEÑ'LjKJ\YǖTrJpqRp$MJj|߼S]4tuZ^X{׺bʺotXȏRm?ŷ7 3.P&Hrkm~)xL֬txDQ<:cpdf,DX#9S I{>ISY{[+\n<'$ ŗ¼E_ܥ\5¢6mϑ\o4jҐݶK J,oPATm$P,,$vY>0k1a1kϿy{{mҹvbcR8JsQ#8,2Oj8OFtSTgCJJzMBnRM+׺tx^[{- ;vIg]j9+Q BvF5lbWo˓}6/ĸ>Y4ĺ,GM -M1 \m%J3XG~~ϧ/lbabt]'dk+%].[[lz-ƫ>oƫ߂N5-3FAP+K <&k۵#f) vB F8@VbLLIXX =[/ aO⇊Bs1àX^鮏#yqƶ⽹6WWZ<'oQVŏ .$PhwIBG#}\yp4 %s8FDuq"|>k|@iDKk/@,W_c*ظдi{iݵu[ZX1rUTUۨÙIۚ m+7?mEŞ߅̫VdWVVXl|=o:bѸXаX ,I$w4߰1ҭ>'xKa3[RG)kpP8nPo85>wI"1"mb,)S!yx?{--uuV ܕvvsH[[N>r7uI'-98*R 68{z=>h욞rkKR O젤`D P2$ѮsC50vc䪯@2pmYY|ݹUDO;/Coo^ ?ᆶ5M;]݂9rz* J&oKYQdÃ@'N ??lG=W`j' thx}Ityo4ŭHf{U}#9EjVMnjZ+轝ߝ~UImЬ"rg$۴u$皒ƾ4҃ZxR]Ee[\: `skeϋo}­HYtKjhI#Z]U/oZV>)i:ۼQi7miQà=pۀw >% NTm?IWXBr%̛j]}b>hdSA򑒅B@~1fKŭRk~'NBbX@),%8}'s\]GQmULZw+8;0HwaNc](잛J6o.#U}We,e6ܑcmicV_𖀑x2RF^@ȍZbV# hӒmou]IQ auf՗H-FDY[w!ui42iZ.KFSx'd3dgGd\VGKE}Wtu/Oq ?ڍ߈_Yjo\,zƒ3۩!c8) Y#m'[5H|/[KꫭjUİNcO6I iF.G|At/C/v՛Cմ>N/lqf3<1f ,^2C[eu Jm#$gyy$o>IBFģ61\m=vM5(kv֫z5[ٽU"O\m(E&ƟA[LcErjGQHd;G_,ھtft$L]>#BQ6UYN q岡  Q4fHt>lfIXD#*n98ubMc5w߮ ~/u^3HfZ5iShBHF|4N|֍~SջhvwdUrsK'C[H5ekI*V?{ܖ#xf W O ^|G˨j6*Frr.twSyV' ^乾OA {[MJO$hKD4dAxU鬱%MM=k駛jՇѷת:nn[˯^׉aUUYD<!T]ח,JD;Qqs^e->^7ҼUjZRʪΘFGp0SQ_<=~i>saXh2bD|( wKx+I=rM bXT4ʦH(|_g+TMGZɻ-ꔭ[m  16%ki}xx/_Kú :}E,#.틔to y,ݬOCz'dx$ZW?H+fIW ݊ƿ*3ocxk%}^p|Iٺn5yCfݹJ(*Wdp^A鲋܄ f32\=`Nz0\1oO0m׺[Mb贕>t_ݵz񦋢\΋,WMүVu8|9 RIy1 DófZ^>2#_Sj: "? x$"_e0 K -g sp:廼`H,Isד>=3FMДkrjZr}vIc}_MRU/?>kJ٣Lڎ|M%ȼo&"XX%;R=Fм)i?^o8^d+HI$ry$s3rdf:jGzu9i"bAzc^ ﺿ+8ӭ~~־W  zk+^!9Iw aKb~b$j`xܐG?NkđWE d>4+Z!ݢmTC+rD! BvVS&\)X|Gw(JH?~b+#;1FxZ]7wQjwm-|!YƈM^ Y ,p 2 5M ^ӗU[NK($KTRpb1 Ie)$ ?yF_Ww6ӻI55,օj,v5 Gknފuk\|A9n@[~`>eާ0@e啃e0ˮ2Z QBHd s̃vAzQfIƛ,e,H*JmP(ǖ4>y{zi~o^/v~Mps_|UP~F$t9$=}ukV$6A,AuRMYy3mxʨ1aOX{~^SV_o/3$Emrdq8?:u_۶zzTihcydqݷ_6.ʭK`619 c_|ϣ{=F^v߶n'[Dy,cیttn`R198ߍ5m7-۰ /A9ӠX6IfNrrr=z@zqz+6,["h'm9>9ױrn:vϾ;&{cJdn# 8۠:hl)ܯ#$gE''89ЏǞչog"y g<r;`anc#?tѓmkk\;vy*F8:3s=ZB~񛓃; zRAu~x23nHut7 }zmv4ϲ݆Ԑ?< pSc|qngyٟG#q;K` ,-R\ <d݂~N{jlqЅ>2qgte•a0rL}AK[Gn߶I|6O] & 9IgA-^˂َH?đp{ tD x|9= &n`䞼zcZl=?~2V\XHU`X$s4˔'i\7mw`F}#$}}<vu|/GATGQҍ?_!kŵ  `rqF{9Tnv2I =Uh77 x МqקpG[3ܕd[)>tב0c8~4A`qϭ_&# c=88jܿj۞<'\oOh̟0- Yz?9d|DZ5k`$1ΠIgf!HݐI'x Ӆ<qj.FqxSӽtu3ooEŢA!$wF[e֊@6;rF;K9@pp:vih"qͷ+?UlqLt^/hѮm2Wiwko]rPs1cF ʋe:PȀ#9 匃 rD'Ҭ}ܞd21ӯ_Nj:}M7=۷o p[PHv/\󓚺`xXʼn!~Q䞠UCrAI [xS:-?Oo~uv._֘1}c1#NRhră~V.ٔ-P.-V@Bn0 *Js p\ pg+6C #9PqqגzMܒA$'(,}O4)Kau 3~Cpx~?}'p:Ns@˟c̤@`}1yzw;ϩ\՟mGON޸pk[CwbH$q שۯ<W--}r8}Z׷A!rcVT sRW<9C)$zOrw=AXު gݭM~}4`=-x~s6cͻ#ٸc'/>%"bN>_I **>]{<$UvwiJRJ*0j4IpωمHpcW*խ9+Ir98oֿ]2$þ.7W^#! S!\;*>6-Zٸl!w?Q$>?ikExΉ"0aW AYN>E,N5ꢲv4՛+]˭lO 7d>ӂ.X7TҺOi7VgV~aa>O+"2I,~dxvG\ψ\|۬ܬIy,FO&QԾ<|KGcj:.o|T2H# 4QiwDXٶFiU6[$"0 )㐖ޡvIW$붡PoQ01ji?Q",2FXd,Ha+J(m4ՓiJs+q⫂8⼋rUjT9Z䣗KFQm{zk9Mo&xcNۑ~\HXm9Tm#i!/xfNKе[IC( E'@9H)tOڮ6ha{]3ˮs41mHk0"ΒF7ԏ.Oug'#Vo GIEI"f.l|oQ% lG"F/6[o-џ]w7y^թ/W{ٟOixJegJ1K aRn,#)B1ZdrjZ${umiuav&}0ǜ؎ᦶYˎifEdž,oԼ/ qKm$BII2$ j̩cÿǍ--s W$M!:KWbǺ3ۓb)O9F)s+86⭤I6n.d읓-$=1W[詫֎\{kz6_ }m7QJc&8w-_2`yo<Ҽlt7G/k.k?k/"\EFd{bD2s}|p$EJfӸ I$qo[͖#!P.+r[5ˮyy.M 9~n{OkjۺoסvO=$АywDFVFbA}ԵkWƚg%x_GdM{Č'Ț7I"6oUQ;~x#ߡD:z;@'9+1VV jƿz_x WS~<_/_z84},ʺz߭\} m6evJQ]_} >nm|E|YjZ ZI9xn7i,Io2CQ¿ ?g=)V[oxEG\6R:pJ ]ƧH|e\$1^$Q30V[?u4=lM黺g7.}jm[Oc o@(ӴK-7HKz4tx!J.ccȅ_i0PN)ԙsv`*106| ~@.spY;bB<->h!NZ7|C1<6W3oѡ*n/Qb^~{]tz%3*tIZ[in{FAf'y(Q<2099;X S@@ GwP2qsX۫&cvT<ٍ 8#y9V`ҏ1I'_“AIgni.1c[OO;i2w0's+<܉2 sN ;߹sOˋ3N0sWY}4-_q|LJCAT6z߇Y oJF.7@$2D$By!~>~m3d[|U qzskvZzv״o=~|/=3eC>$kU4VطyVO>| ?cjzkOj뭼Lkȭ jP:pASY[xFIݴgps.Nk-CS[#̖ [Ͼ TUsb38oWV*)ץwkɃ®vi߷q{쏈cr`[)FT;J* #Á±OJMR/zД(]ۉO}߇[zn]u -5 ]e5c`nHTEpc쌾c?};d 6ٚ^5h C*,?yC Xdp:8jtvin.[i=gJpwϛVVw?gRUߥiz(``bI@!$Mrڇ_ݛ4-L*li~['0pm}gk"m-Kn+E+93:/ڦLf!Ȅv/J:<.H4v=IuXi"I!JZf,r?0vv﷭ꖖ-a~s/K|z5^͵eM?ˡxϤ,6 ?(B!*>+<~J)<~~8ѯMk~ GeP 7"%dbBfߝZY]Bthi# i2;1FTR66F m2Fo)z]Jn4i_MK UEyɪꓹ\lҒ#V[*n0m2 yrqМ>X]G%|sꋧ[]#,Ud{xfWJܪ|dޓ]:ޅɨjZŭrq+ 8xHȲAl ;I$'[3-+5kI hշݴ[WS#Re} `x'Ovu;~B?!HHGˑ:o| ]\7 N9nmRq9b*IˢB[HC<jʐ6*E.\F&[Y-Zi+Ts)cxF[t_OH>"ebT' Yؐ0hK~l$5 g݁ЌAا/m v(l|Z dy*9g%x?| Ɨf+mC}?avMmF ebCإ<<(֭Z۽R]i꘵ou[]zSomG]N`y盖бEGα,n6˽crG*iG(6?G4?6>5vcԣլ.O Ek>/mF1Bt$;\Y:n$Hn-jҿ=jIhR۽r5sY+K=(foczS|KY]sZJɵPAkϫkqi4%n}>Z,{%Ċ[ژ/ mTzvpM L4Zdž>k!w3tX5k՟ :|vdPбQm+gX?U7=r'P. Xt(JRp6#ݗ)C`п~h|Wb13vMEFqkgO˛/w_`*(x1Q5S{/. 4=zF9"h2=;%-I#'Cr ㍦HbGLICpxwW7g}̋*4vX\00՞QIFVZTշʵiY/b-~vGeψ0F= fK"WS, ~rqN265z=f?1|rVC+!Rdq2jPQ$J#VI+ЌG!IjmF㏅(49Ʒ{흘d^?|ȮO9EZy];kuvVnk¿q'sá _ZmK5xI9 C?00qGpE)wQ`QQH&2)/!8 ~1~ @{A}Z?hnhzaYU亖{{vcH.`sG72Jon. 0K4h vPvFys,;6W-tm)ft)?jZu}?n #P`9C-'V˂$kF1!XI?Op.Sͳc$.J $w@8Xm韰!n[্FOIU y$M92QFp8O!4IJmK[miױӦM+XXk=驨/<0FUcMʬz$Y<b&bHrWp$o#E~i~= C"[YM71@4I Uev-is?A7Mj>"Bڜ&C n*I3B̪du2)V׵u ?u=kײ~KN^/TݮSvnkp0NqF2IrAI8stKXmhHIƭDbH)s䪕>,~5ŷkS>ܚ)ceB]%^J3 g*`{3g&ѿ%l#T!ǹV6gPɄdۘe*ZtfM~ M-fVy(W/+I R|7Yh{/ꗶVTմ:WV{7lf_ͭ1WM^M%5 5"V\5 JJE (r@\lSrfk,-K൵y,'-&˷ 7^Əg/2صeo&q"Z$&j3ġ!RWoݿu) 3QWR~a[=K巇녖M<@н HG8%{AVxK ,ejN2#le JKsM4jV\kK:b1PS4Ǖj5=eg) -۳Z|HfOG+O:B֧d䵸];ʖ8bpѳ >ũjiZ[kw+`:wuإLX^E0bhZPKh_/ gno`/vim~5D̷Ν]6/&KL?f:n#+GFҴ^|2,hUS+T@ T%v vOQM$`MoNXlOy(Ԓ\I_ Y_k+^2qnƆ:æ!-98̧jpYF9v?%L d]͋h;|F"4*IBI>;;%jzũ+{xUm@ !#O`8 b$ZwriwԝYˇHK$\$,TG,++ZWOtY3ӆJi(M5{4V~? Ь TWS~Q'[s.#[UAf,+!FG<25K薾^J󪚼:hM-]> Oڀ_˕FBn$+m*lW96YYAˌA Xt#|+#6Lzw#z*$`FoͼnR6YP~om-[VWVT1))e%_7&{XhѫꡆEM/uͧK_כw]M:;]m@8b=6-e8I^RXOmFqmQ뎿t+oBIlK'768v0 soi~./zּ .DlT|mm%6zTacYi(#GXӀ:2q>jmkˡj-}UdsVk嵼vI2cIשZH0pN?V˜{oފ-t峵.n}^mCl23q?'zsVQu s?O+z۾_u:Y3=#wqؒqܪH[hIOL{ut,#rzwSO lb 3Q3d}I`cIssZm@9<ןnPr|=^V^R018Q7xә%E2]B>C¥(l'qϷg\ # zV?s;c I9#h5]ݵwӱóQbLA<pI9wt"{iu ]@jB*͵!"!Hg|ED]T$ n zN@p>"$em (v/riwdxݱg7[txNky:ڷM(Z]]Ar$ce#I z[|vV[Zna~wSY3fhN(#$  4: 10JCrN@x xI#oPrWd2 o|V59oH+M^pqhROI-W_zuQح{4+[M}I״JF6ccգi3ю{Cq_+.д7iᏱtSmĤ Ÿj*C\|Uh`UC wjZ:/gAngğ ITϱ.V'!@*B` -nMaFTsۃH%+&0ۯ>Kkψ13YFTŧ"XpC)$83O[) 3A\aNSBtK Q$ Rm\dOO+"sz 9,j8zj t6v.k:leۡws9',F@rINm+ZCH=8#>̟:~A;fISdx$jD]'rHSF%_>޾hgOuuv~Wf1$hgߒ0I^ SpGͻݜFsګKb#X)7끂d̠\lC # 8;=GT-ת7Z$$2RW% !#;rdv {gzq i%YYUf]2VPpvdۅgBIb sW^.kY3=0yUpիIY-诲ﲽ]w~=F=oYP> \3$=]5! fYDυVBG!*T^'qPbPӑijG%KMm#H-ى&({C0[\a# pApO])~p{Z[ں;oP{֍jz#ZwKqH֏M7_/IO1ʼKHffT5-a:>a&pW)#2VB $Cp.nMy-xpr81ZhIW2w9]Pr}߇OMbX<:jmV!ojF? <ϞPUnnVl26Wnj>{᠎|GHϻ^$PC+,wMŰ݀+p@c8NLچ\v Tg= {I%ī$[m嶝-nGO6  U.8!2O\8=3ᮍaCz|NJy"T)xtc(ĥkrV!8Ěr7h\B }R yee+d A~bO [zegk~_0X߬MtsMiW6kj ta]`ebRN,^OIt^꺥ubN0pl||jhai۳:$)˕?(IδD]rvC&Oj6Uu^Y5Z77wvZmv_.Y;.O]5z}m' |o2u-N8X`U h1U;#$3k [XS)sd0 2#km1mh 3k, NF0rr k[Uhvu^tky~rh?.}]L׼1o x+i%ִ_eɌ$+B4Bd s¾1♣<#Q4Cz2⨕?k*\5[OiڅGmw-6w`գݣm`6MrC~I3t9V9.rY@gSXȯ!f՛mJV4ӺOGm_Mz֍Kmon>t H|/? mw)xFIdAmmĐ|߽* ){ak! IkjM7q<@[#Fw-4 RXP"n^6L#iV$o'90I$3zW} 3f"VI+Զ$ڲFo[ B $od'vm<&wlٿi?ډodoo2Ac[+}ԯ͉cIhHj 1XIO$N@k. YDunXx$pUsWcճ6ߙ`>nz6O_\Tmį%Uk$Kem-}B=WK^9#\~ԶSΝ7$)ykNR78[ޗ?cMWfh1u()f$FfR61v`zwjnf_\q2<tgؕ.i߹io38WO v_UYB 0'VY%i;<3C:ۗayl;]#>o /^n%rI@L\,: ve"?l[D&K5t_܇U<¨m@;tpG8bIݰ@Υ".¨P<9 0f9{1K-l{{ti<0[Kɻk-m`\)?oK$w_XхAv!Gѭguk ~Ӻ֓iZ^Kom&: ^,rNp)fQy Ӝ{ƉwUc`,[R5M'\,O4o=B"2 T#%>YCPp\Zͮ.^x l\dotG A$GMv.ӺuGQRg F9Q$A%@7<펝5jZi :f7[P/$W9,tTǶB] 9ـ:kfk-ۀNtڕ>dIb=OnW.jARonK z 5;K[VT\Kzʮ#]pDepm(|(|v^KMJo p 9^\zs=x9=:%.vOqIp3U`w($H  bm4-H!rPAݒ6+!O'CtG=H21=Iy?|kl:~a;@4Fчͻk,̀F^|R(gu-6GC&;gH2v.rt|+<:]"Oݞж(RF8{q*x; ?ZuhAj(A8G9L#H.mK=r1l$j7XZW޿%JF0 Ni.YjbkH-qsw4W5=Z M}6qUF~`x%bEV0JeGMi}7U>;+v3@4-I$l`>!W-H;Xl*Kc0gkRxgşc|G)sqmMHn8՜rȄ4dl5ݜ:ß44&JgFN2ɼdQ!`J>Kv%м}1n5n2DJD!*,3oql{9=:񥎩Fl<թzFU OLFcy*}.R-?uj̏QP29=*q VŶ~Lzc+~﷟]3up3ϿI^\N[ $߷oVx~_`c=9ϰ-J o|v8 \w=5Fx>NKoAP^=z#~5o쟾8۶{x^^sM78ONma2g'\[\0G coεm[ٱguAr@ϯӞAsGPxϱ}w;UŞy`pAMcAǡZEp 9/?ԏ1Å#98 8`H~?^O2Aۡ#?=Ϩ8Vly?-TӓӓrIy-b܎6 㱬=oLU Yl6.G})>q܌18<[rFU2c\0x8<8; r=y>\l~Y3Y prq?nԆyPxk;57U\를Omn#9 cCۑyWq(.;N~@x8܂iV0ߵ[!r02@8x9:V>Dt학A]#s8[Gߝ6XكcVM,F'\wt@ 9OSsXy@^8%r {UG6Ӹ|q}srOt mS>0U̎;Bm52-^t[ PJddA%@$d>tַ6{6 \n 󼁃ҟ^ T8 g RWV~Em/k+^kvRMY.7_x?~-;xB`DK>Oxv(A8BjZ߉t [:VH٫ZHF HeK,I$^iVąE1zr/1E %QcBXy ,+qkz}N];ֿ7A]E BPB3qniWMwu+2+zΥP m2j Y>`u=IwWR;YWWo)yW$ º+PȐh0#hf,KcEkb!v.N_$l8n˥K9^XA;ь I !,M1Tn$c )xdX> Oj7niar%r<isq O¾ 8 : 0>Ww}egSG[t^r~`ի'xOd~`nvk6j۵u׉۔1SfpKp@Wv^g\xHOJŐk~@ڼ++&dmmav{&V6, Tɬ?d[wûjw[y^zskfnk]p[#<P0-Ԑyn26S\R9>v+KԴSD4 ;30#+jH't߷S8lT=AwZ`+iۛTMV]ΥR>]]Y2"͆8U'pW^\i3 7U@'~Ap*y >^(V n~ly' &F2X\`fS$s)[u}y~?*7w6ߚ!cw,7c9;y5voj) =T] {o7 :q3֗MESr89 9`{3I=" 3qO#QcA?W*YT xe(c9<qR&qp3j{??).C}±g˕ '8^qjٔۂ2:s0;iS t$py' dw9tc* W`y=l Ojiko]5uv[]} Wm rv629ouktn~S9t3A<ZC#nb& ;XGY6Vj,{C&H$t!q.v9霐Aݷ{]VY݂sD2< r+EEK09/<;3b#=qF:kt~M][ɯC:m F8ONkNW ,~G q!Iq6;gqS q ? VcC`Q$Pd)=[ܓB?O8(Eѕ寥WSm[[\}-GAdgj/v6L$ s2$Fx8ɯG]X%ARr@G$c8ɭ}Jcq'$'ho޿A;y-H͕`)܍88:pCx#tE]GZ kmm=I8''_\5WO/ʮmVN+n}C9* dK <WѶG-68 8`p;8$U<Nq9uo~jpSMUvSdp:mY^)޻ <=Vqsׁ߷\ن67mA)8\sqo0'?>=0jڨ$r^5埕88S:W@l99S$vsS.n/{Ho9 NCoBIc*y$q9Ws5-lAp8X[osm_Zm*A '8* iuuk%Ո4r4SPS2[v"a ُAFpH6t?Iu-+%@nX.ܳdq#!tlf##c=:jx}x ]OEyoYR8 ܜn $N zA&f7op$.01p[hEd.is;:~|VͽCqðקa]߇s&MyRyds^:玄յiI[[ A N$AzH湻İl67?(ƚ1ӏ$jNm/o_^,+2 꺗|Oj:/9Ez4}ug_aYrJ5K -%6hDrUw}qd֨K$^WOywk ju4Ɖŗj`~6h>0Wv#铚_[iyoMɯӯO[YEEev{$=t6E&^:FO8KmmrԱ2yR2jͳCKgw``>Q8Z;^#PͯyYzG oudb`JItՀX ǜYrm-TH あpsJ XPH;_/ m"G~w: M2=1ުqq|{S-{e |t8x'umH$G$ukB7u`i}):&[jiQGI+csmgĎYGD?_/=v{Q6Bs6Ѵ9N8;8{$R8wi䚏9$H'dl d?جK5`D ԹLP\E"=ܼ&y~zc˹mx.WSe;IEB8 ެTLޫ:qLHpͷ6w5=٥@Uێ 6CIjN>Ĝ2?IA'5ԕw_V#P>[O)Zh6ӫ}R`w՜ 9ROL.aAb@8$qc#,s)wWS9pv2fb Qt׷˧bK]ʹ#~@$ 1׫.;#MlskjP9 ?8v*3120Ah<@8]/؈rUӀ2?8ʂ0A >j #Hg3ǿgT6|ݞ߭pŏf`6m'vuseoϓyʣ61U[.;mu;\'ⴱX ǝJ܍|-cX&d%ĪdX PtSq|CTV~m #`pѲYJp2_^xRlJj7a1yq\ 5g##\ؿ2;Ij[$`ߎg͚$lo9:SF$8ؤ|H KehpwTVm_ilF!KR7C3oz9 T:?qY vr %՛;w$0?8$p~@c1),CvKwkF޶_>em[ᯈVVU5O k)Wz#)/Fn|5a68<2o;.H]eOzs5M"T86=Z֦5 П!]!\] `82ږMSѬDRٔUžs 6v]Aܾr^uiskY%675Wē%{-|UJ AQzkAuz&F^9B'ϹÏ<|3m=_K,(܁ݶ (]śV#H&YZ+9}ZBʗfwr2ʒ6SzK-ow:?5Vc>FUCq2TfUW0gV\u6\3b#'$IIxVy-^&?$F9Ќ{ PA?f\H3{_l7m7xwܙ Ў8jf?hA0gOLVOO~|B>z#7'ݒnE:>=?TV*|Rʞuh:PB~}Q:#Q 2FU+7wIW4~w{f03=zY<6=CXdk=LݒVCLI0K(Y]$|;Vmհv 02' AH 3-\Y !Dp~BFHP8{w ՙI瞼Dne^x (P"ϋ |0@'0r2:cݽzL% o#RqG9sU.'ڪ`0YڲppH9uۚc|Ǿk`og4>^vg)\ă$z_hAp@BFyzr{;OnspF?>:TV8kqL{UnPHN~#?8\.RF p1qWMͩܜ9t]~_G9O0@=kH+rTH8ǚ-nm@6e pO;t#p$jKd $vŽ8۰ɿRʐa.8$qKp?|0 8#+Af=Xs؜߿\ӋpI9SasnܞБֺ@x~{T4 \8O9<t PH{c߭6 ?{p{J`+N)ֳ\gnm0cC~-77'Sߏ~J}x{>ӌz~$jb)´P_o]L(DNNq<ビϧGrI$AA=MTkas?A8p88x'K=i!s==ǿyYؖI^21F0JrANAҮ[X9''\~CڵIe>3FN^?m-,@-$FI9${w >k1\g$(-cuj%Ir}35̷_k aG2qnkbm 2gg#' `pvM `2d 砟[H@gۍ$#c5]ZnEO$Ͻ]״Pݸ`ЀNWAgƴwgӿ[#6I9cӪ`f] #D@ѕ󐠒rs~ 6=qǽϔgdڹD}ߗc_㵽kQf^`r?iuOLgu=h-ng1^ݾ-Tpヷ?yhW-Us/~sof2Eټ[p;p;p`0=IBȮv$ndm=+=;$sާO>S],6;%#$ge!%pA}y'ץ cz-n qzB n޺98aF I\UKVkbw0K8`]iiTAd]ög͙,0jD "| 7XM/-f$v@y p2'$\R\eH$79x5CPHm^퐼36(c9Y֗1V@;p@`xt!q^{>$ F?d$Q%\>8vuxڅ %UhтN QiVmiIvgvx-d!%4Ww^6ÍBTRU ohrjgu r4n]jil07qWSvNC;@P !FiZ-ٍ IOX8'$xoX(PA'.'q!#PiuoEj=Wu'O8|M-7-.H:`pY2WR{Pdl1!s>xor.O߼&GzQw![ذ=8ozTRvV~K齵3n.~A'?#>=rQk\ KRNь}8''$5]Z8<7`8fxTXj?cRzN\pz ۠kuE&oͩ^/qӶ2A-@ \`pG OUӾxT vI9;EmݍnČm'^ޯM:c{=!S,_4`Bʀ;BrN𦝬\Moƚy2U9J({މhRوYA2@9a$FI"9o,ťد,rR]0;zdxnY~W+?}?OOeO3;/E<:W!_@8זO>4R@>Y/1#c*|GO nh%u4`DsGYKteY+MF[FKRH%;$r$uC}8Gkf,=mXYk tPjXW{ydc?zKW|gϗ*;o5-2{wqSzq5kqcc{$ Ƕs+酷zH-Jk5KF\F1x<ti)rw[T-5֔n#!Kk(4@t  h~귋cAiul _3r۶66o7 ʷA9z Q}eڭ&PFF9ɏk.'$ 1^m{}{>Zo~.vt7-Pv $HNc )9tᅔA5` 3999GI]'4HvC`TI/8ʦ7|6? XxZtsz6c!Ĭ-.3ca^omMEoi;nmGI[hZ%K^ڭ'i{NLgzfp%F'p1õ#, 6.[q$GQx,m5OW䔶H0c(G-H00 Re}@ q6'0}ѻ`A!]V8|"]uӽZש^Os/Ni_=KL{^ya{j?͕ٗV#lJ25 06l'$S|ڝ;ä,IB90& ɮxfV/JBh`Bo);@@©+^麖sx-t-¢aVP!r/>7 _7ɷ{om_e{t?o/6};{7u Uxܑ=:d}/Fݐ7T.+!Qc@q=2ٯYxھjI9u!ʐl;~N:6pW/=Dx9F9ˡUkKy߶.n?o-꫼vPs ȸ,.%FG 8or@#鞇 -A<q\rvIŔR7/Q׸zk,*IA|un.n$ R<ӜlClYjiOɵBetG\V>=]c>f-A) x=iæikk_ >R jmR0B /M E*z-c:W*:;}yǿwk7&;EB^A1Tk˨џ)PH`Ndovm ['$d c`Ap˞2 8<{nr+ty}o_z/Zx{\j?/؈9 vR.>҈7Z/yV\ z`Iou{p[]7qhhOL烵Bcf8XV6?]ɮӯJcp/Xgd,Aq pZ w|ǩH9 8FtlaXA$nyʌ9'vk[*I o pdO;uh7;kk<tj7طkc6HQ 9P?wͮL-{cbZ[U;H*cW|̧:m(nBBiiފ%r}:;{M>*ڵ#yeX# 5`B>ngF6Ѫm}wPO%啍`906[=.EܬNpFFeb6-nxb 8NO=G'YXZٵ}i-C>9۹W~F3~ɿO.W7efw~]fVI,A N;Pr:zW@r߻pe1' we`KJ ##mhVd*n–]ن՛\9.&}2[fɥ;D# 9@*ijRvB͛$@Xd`#$V88,'h299P8(ћVvz$<8.gyɭ=wWmWO[JT +m_b@,q101Cz[kl0H x$cnp]UUTn8*N29 Rکe[X͕QʱܠĕOwlS~}8ct K{[Q Zx rxcgؗp <\dZnQ pޠdc};r Bk>mU^<"ܓ8c~z*(M۹FjJ@vfT,2v./Ep>{aon\'b[[[ 8c=2~[n'׃ީ?4H{qҩu| :z)Y%ȵspr6y:`<=*텺->ܺ~``  {˳rx$T8>khuͩggsƞY,}wuu^NmocUOU^mWu j:p$Lr DQ$f…RHl]~Fgp1ڹˇIno7` +ܥC) Ű眔8sKVzʷy;ZKWI*Zչ_PIǯ;ӕkui] 鴳#lnTaraA u>(ק$%ݹY[O70A߸I#, c9< cen2x@MN$VVUۭTJMmy>" nA݌䑑߮pG/5`2y=Xcj 0;9 dr:Kv76N{"gO_6H؆bX+ɑܞ±&7] ==t Km )za_gV/t=l\ [Qv0 x9adXV{MldnV{9,]6s{woo͐Ѝcq<3Ǹkk 2˸.9%N1 k ֗[Iuwa CNF܀0 c?0dHt9`--v,qs?1kώad1А01:Gȟ6%X~잊Ns9]/Iuו[[ӜmF E /-WNTV$*1ARX%|<d`k|9Y}%VB1c;݆jo܋*4Hvel .ʜm^\@-w` 㞠 0עۺ^OeM{onZ+|_w3^":m Qȩ.Z3ӸZ˯}@n3#SU봜r ?u-2r#@_'m@뤂mG9ϯ~Ibq^ieo幅K俭7^gȷ%,{o׊=fn.A 2 5l nU54Oi׺]8<(@'>#ڍ G˒paUhsqu&<WizUfO0I>(|\𭝏"*TܤaH mgp8h\,a[`qyR&Ϳ;lY.WxNnj+PTtS> k3Ig}ل`ȡ(GH+؃!sVktVn-5O_won蚳unN]?mQ`G!%N2`罃Uҵ96mUv0$1F~bq_0 Rשּׁ隮7򪡇 Wci hcf>;/ɋXUB+v+tofm魷:j-6j! uem8p08*ߚsnp8|g%f C/XT99d/šM<̌(-:t$ -;4;/ ; Ӷ_qT)V@H4nhH >f0 `s۝?DӴAcc!Օz|q&@Tv@#as5Nq3'ׯ~?1Jg)-զG̷$0 AO|=qqcU+ n 97?*{䞼qnffxޥAbys*K S$VWdqdNA#h*0NA@MٵFP5!c smn2G#$`rz`kgA `P5c%OW y `佂;=Xw>p;mcoO] *8'rpܛ{gW|llM`_IY|LPeB@%K~Yvڮtg%}8R1s^1 .M]pc90Gk^DH?oX\̿/3q$+eƋl~p+$I=`4\ӳn \Nx{ta-|peNp~`wN~YH8IVݽ[z`q_o&czgA'w H㎣4/}+[y~S @# N6jpp@,ñ#FFJvyOv\ 8Xxc,&?˯>q{7k~_qj-v^v{?eALG$YlrF qxj܋>8#'p=2pG~zt} ~ԿO?qshnEٷ@LJc x4~9ջ{[K.۾d3ӿNORKH8ը/^YΫowGכ]kppBp|*gr0 ߧ Q~Q K7"ޱRq.O$7͌1' bml-D9B4hUyH/-E~ܯM]7ӡ]OqZv1- 56{.G(]cdtw]O3ة߾n')nAN+uYY@#hʌgYpLw#r hnn29mpdepI9-IRߋ $mI|@ry 9>GMڝ =?!n96:d6T1ݍǒ{z p2p88'eNq;uq?0»zOn8:e_d8 nH$<*4*v5{E򷘹kϝ4ɜf{r؍[;Xcw#OZH]v66('9oo'- mU+~8@=:Dw[f;N@8Ea]{_W:從suh&<.a30-h܏gdez8ު\\FMӹSdΪP)QCny14?gbTREP$X1Y,+/i=BnOEخ-k*HayJNzUsexW<`ذSZg؁u|4R=D;_k h1N_00;JMkWMfIV#-"*Jk}}mNI_eu9KUcd!6`l)J X0Ͻ{_?ŋc Ö>k`*dwQS5>pMQE}6>A|}o҄w/ ? 0Y*m!5_od"J=_[S'#oH@iUi"5;ۅE*KU$f'kT>|8-a9l*郇 prT.Wz{]w]{HɧFm-A#%MwG,*e]f8]zxgR9]쫦@$*I]bYg Z;/7g~&FXyX,DP ګlぜ-{i|~[i!|2g*ťlj$12 @n]-Noɢ_=kyi}̮IRv1[7 4 JFp?08aQH遁_!0~>SEைQnkqlAydܮ `n ݂0Oڲ][ѓ)$M 擧Kcc*xjIyXCq4iLWmjj}gu5wjI"wd9qmlmH8$g sl|k|)CPqi"TߧK^k}VmR )$?29W8PDzfjU[HB0Dە-BR Eznw$KIb_e[juh9n  zPIkUkf8' 9N|E% & Nqm8:YףKr4k!DP:nݸ*"?i0 yy$tڻ&ҝ ]^NMGe9ۦGV$5A6{9y \ףnCn;jʑ^#`Y%Ydrr9*W.r{} L;e'+,smm2W'$dGC~n}r1mלz1ZĬ Mߘq}y5VGL}֩%}o'9Ֆh~7^6ɹA@H6 2wbm2s A+1Xdg'9Xڻڗetuhc=1qb{F=+aJۅn AOl}Oϧu++KseX{_vI,Fy` 9b6[EC_:vPs"3 ğ1o8^by>FE7S ۆ@[ c-֫sۜ`xI[@!d㑎!rcƶnpW[r+ݹ'΀I wSWݾ5ohkmy_d=/,w`$`z6mp r cwRjV$v$#MBgc6A ON0N2%[n80pF8>8Ʈږ8^8``g=5ʛ%k߰8|XpH]>N5&]/qX Ű+,s*H^zw_e۷,(,cvTpx' t4t.Rp ɽHtv89Ϯ9[[cwn6=CsH r:qY_afMJ'6pN~ݽ;b-T[X8?{scxJsx=ráoЕ]gm-ma$u{u%9'QrH C $d62qqr>GD9L `'h<0Z7ۯ,=NrϸfElxǷڛOT,WBq}py#;p[##1]?nDK$G$dvGz5pYgڿ.u5 IׇvrxssW9O{~>ʾ5쮵wC*n`T^_E .V" OA`gT1$x sک`\[GN# tqKYOü&Lڕȇ#$d`d4ߵ8b9>Г=}k^NB qx=VèWt•#Z_{K^7 ֎sK>#%tHA]# 71%~SMޭCBb-w@i#U»x8]H}@9ۃC[V w϶{ҶvkLN1 `Q^]|7=mjn. $ٰ-n&t?/eϋ~֣_ФbLJ'&E_-%U%[ԬG-~S>|D-_Bu_40m.nw >M7%Epf|rAP2 $8Tn m\\vNNA +VW5Jϓ\ZwTnMgb) kczZm},$=QL_#,K_xPd+E BV5"*DXԾ*UDZ:p#ayopSt6jB HFy8˟m>/{s^,ZE mEN90 2o/( A5͔,c aI e1_7q?y~c*m"b-wOmbޟOSgqizfV!#K1`Pr3k gw5[Z#o$kO[?ec; q 1⪩(W!Ay ŭ荈#B=ycJ-# $FI$sQ`_h]kmR#Ig85L]]9lNo9Z![ j"(UN<3ۜX!  %ƽ0f-A9`N8,H擥Fn=dֶKy?Mnto.nW0$@Ht'k-nةbcp1spjsPo* x!HB~Rq\%k)p m oZv݌q2Fl11\ƅtcԐs8y9s^Bz960yN0NU'Ih=2g uCgۗmGX\*كdH_0dN6drxVOYϐB@,,o%Kq>iqkl NS ދDN0Vqʩ# 87BhNkE[(QX 9f^{@0M]gK|lNAq+ 5Ί.kKa1&̾f];*<]hz̀Sf Xv<yӜNHŊ e*dmo5;gk+$ZCgUg9xkBRu@X08 7P2<= E5҃~mlWd'JXWZigub[Uc1+wzwBr0_ "[ dllu+ Vr`#4l;e,ybŊ0#wF]RP9#Hϙٜ2DT70$B_O:jz ײ_ׯMyh<f/ywd[P{u52 UC@u*GU>e}GO:+"l T3cz`#]|& )t$X); `">YX+^(u-bC+\b'.|Nڶ:+S$׳{_[J/gevM_ѥ^0Ʌ˸F\<7{-KUY5TqmK+btXl_-r o4{JC2_c?ˡ[y'Wa4+ 0I22@Kߴo}s_ڽ>a.bkS߷_cJqTFFf]N8)ں[XO?[ϓ@hMdEZV(bu:5P"Oݯ#;i|Ե>9  ш,QJo`iK$ lp`3>n˕,3_=/[4cTڕ+jvN_u?;>_]^l4U@(`v2em2m݌nyѿc4Km7kpcBgNRXp2O[]Ik}glros@VBFXRYp a6X ,s]{寧ؚMm?Wc~tm^Qh7iξPfP3mP|ҙmùDknnYf*)N},ܙ|S. jE+ s0 Hp݀}gbqKY7kY[s_c.>|%{I!s{eE 7BTTdak_w]jO|/F&5 (1  KBk)A:f)"Fr~|Y dqr |Il $xt].j>֒]Zv|}$:z% H6<$Q(rsmb_WGῇf-3R4%\knU}v:!-N*]]7 e!8xo.7x~ NinLel!R%sV{V%J V:0QIZznMUY>m"rPF2LBH\ fҾciakJgra"ŊS,Xܛ/MyXq~@2HUW!~>+׬P|[e#Y I+N*9 7JVIvV#{_+kGn&>[&,cnu%'Cw7D F\$g#8d=? > v8]X>Z9[AL7S:`UV ˞.}ߞCXi-]>>YM=ɑр's!wm޹ێkվ~hzs]A&@Wi #rDX7ސ~ Ӗh+rp+I8 wow5D8d;7fږ&$ӵݼsT+Y&".]GKyF׺oᶿ-BI$<_wotƚO1.]..e#("V@:φ%]^#w+}IYtmoI^ȗ$!+K/o[[l METl vjX"7X D%nL1|䳂Y#>e:$v~r/mҷVAѺӜih?gN4o aǚ}2h!St]ZnFCbO- I/ixZS] x?ED I%)R; I;3ra7fN5:h!V$HQ$e$$HmΟ~'HOl Eud6#2UJ]ݘGVF[_K醴-k9㈪k kv;.6ݮ~5+:_o'~;ֈ/5;GQcqem{Eg NU}^/!.. ʰ/a զm%tf@!UϵZ)VVhabѧx5xc@d^4E::6&BmB+?k j>uVME$G|;nfHYYm '#zJ7v嵮tɨ[jZO&]T@/0Y)6J ]5 5i;ԅw8<1ww9*[הOx_gktFZ[k[urVn+o  \A*z]1GF:z  $;+ԩ#4jڈ y\t$q;μovp<֨/鶻k$sg t|өp՛$eq}]C`ڲu_G:8H#dpFAn6VYXÐ[s9jdkaƪgj m0rZ-뫏b1S߿bğsc<<Ϯi!#1݀Xpx+OgﶁB7w+jV1pspCv=r{]c*9q8g [qxYzu ہ<2OqA&;8bF~4GUvHpY a-<$ƁR4GU]]`WQ&s_~S: Hʰ'=@'1Km'qO9'֯yto// qFgP?6(^ zsG~M?Yw]vϯkj8@8=:~ҩK#U ,~by8=*ק s]j-V~>~_60Xn,$g=8jڼfy#~g=ž#G|z[*䵝ǣsOLǦkk{7M<һKH& G8c2j`A`N8>=9Pi\/Jϐ+HFWUz~3:C>xK QWZy.y3P?g_ko|MT]0f`U ncQ>aVF-Ɩ8$J(WK!eخHn=ۏ i%ޙe5$MC:aY3p#3G;(wenWKӬSFUU6PJy ?9V34gtIlk AO]۾i>|gb,SL5+j˳Y2I)2 F1#"xoH=]|i4{+o Dx;![Yn8-(;%şW)4BTӥKD2%Y;HĘ2蠰WznuW(en@$TdG@è-)^:I׬mhseך)kءAQMssVFoJ<=xO6iNRt9d܈$` eQmetnid'X";9ݖB~DPW3wm}M<9dgz屔R2qWdмLY.mfӛT>6لa.Jc#ɽ/' nENmiV UqC: /pgpTpOc:dT'-<$}tvV]mSl@\WLā#"6F'!Akfnxc (oBB,No;ɮsӴ;X3NI%cLOzź~8\n{{7|[k_ Z ))J7&'-u}h|N +˝|Mj-{K;>U4jb^O<+d3I ~VCV*pV"%98#9h%%6ߴPdUq> "eX`1+2 6>\~!U׼`lxq?̪XghTBIRvׯkK6kyϬ{j:$T4٩;EwBQKm]+J{)C:\ۀW|n?~x #+H. A Xna ǂ|Vga࿅~O:}5A9K:2GĜp@;ֱ]ZMi:v*it}20G$e&f :{>ijݵ}6Ww"6ti7tۻӕ|{i~{R+u-'ptU R9 ,)>'-] i dВgҐyQ˙8.6(bYKTYnE&ۗ ҳFV8 85.7m<9CfA F9}U7{ʻ ium3F RV>_XYXJBQl +c,*>|wJ΃;8m,!7ď do±?/7گ5?RN72+@^>O!ÿh.?^]*2Q2I#nU$nGk-NF#{Yf*nnq:gp\dWy׬":Nkhk6խ^CkM^<▩׭ooրYvdvrT 7g =-~cPGM=F6*T'S ɴߴOq>y<ϕB*q . nR)-W?ĸ,B |H}PAv,>nY *N p3zw.PI];hdPp$yjf"͏ڙ ۂ&ÁtyegP `~l瑎z⩈-l罳2l5 9-`PĀG9 [yBۛBU$('*PF1ūk;EI r~mk)け;{۞6g{uɿ3Hܣp@@n7[[qzQq@$:g$gphݘ-Oڹܤ Xne 9\12qlAH V(,vJ1I*/̪E5@( d" xےI8€IETkk,?-*0S 2wSƵoX3vNA/9N:׊ݭJS(Cvlq]d.\^^]^-f rr [#ݐ8V-isv/PA(N ;A#~3u+].98=0~xx_Ú |AMgGv̥@hUʪ)ʓ^sg`R@|:6)$|mΣihؓ[]?ib5G7 `{M_]J.VW鯢>KEm'v[M~޴wgenTSUXKxoRKlzRGs Քr:_ph[Z '!'-At>z}{`߯J߳oT5F q_>DWy(#k0~_4{OXϘ3*RIBYm/wrO=Ům~1<IɸnN{[]|O ͡g'% p0 pܵA-nF 8aHO cXn6GڎX?+Dž'$dgųZc\#=3@$-zA j 9x=zm5E XRqr]tomvzgh ˖~0 e @V̠gJqR_mmD\m^2 Z\eGm7ROV,t{ۅvLT p}e@u\FFy [~Wͻwª*l~-ʿ0`8۱ϥS3  #3X1_^ )ngnsZF<OJZ^Ym Yy@1H=ɪ {LϨ#9[{; 'Ny3ޅ[eʺ-<.&Bs:\d~Ug$rrTntdqsYPHJ)@˶EX0KUYwm[庰O3vkj-eFR@F:l6mM'u\)$-'j嵱`CdryKvұmV:>NzII'< 'o=R0 RPw"ziU|5Nѓ7c͜_ { a={m;'6Gr I*:r<N@nl!fX,$m c[yE.BnbH _F3ʸd=2pxdtgWi80GlkVr}:jۯɿ]? ged4K+9 vu#q<`bY^[ z>qcĎ~\+\vcL1 ` ahc ry1B{>smm>Bm.ʑ06rH#cGUqz?6=uAl Np{Uț7798F@'c0qU&Z}!I H3^HVu&Ϳ٢#)nȥ!zԃUu!vfieB%h\˹WY>U K@UM+9,4iZ M!PH+c #gB* P 198>5l]X*m9oDLKdvOdYL]fċ GN>` Wm'̯2<ϛӻ_p_~/bT4T\2Fs,qڃqfa; Vtwo}eYyzVd"R9#~nd6˨D4M*HG!,@9`k.ov`<0 @7pggiZ`gP<+/* a@:A"n rTpx< $F3TAro,F,1o(ԐU@|KR_Z\j"=O5?Pd`rrZYjEAhe'dvS[(Үݬ2ۻw\\+a\ <_a^CC}tˀTc I8uڣpEt@P&~\d#&㈕Ni(f;Z-{'v!'w׺Tש?ْ{ax"k8rwFTNI\9V`߄_|~T9T.];TeHfVxF|' @02H8 >#ƺ~i>*v٫HB$0E]BE$jS+]+.6T1-ajV+ZL]`qz kK%7-qpTdw$bpP]\]?0PNGNAIOZp?gpH$䑜I<?_WZ\ \>~`#8 F3ԁϩ5rp< aF$cOkWvt9[r/NoKr i"iYu9qx8}?R;chCє}WcӦhCN=U^}~յ:9Sڋ|yy=Ñ,8LyCߎr`_yx %0{`rp'?6H$`c@8(KnRWJ! BLqƧt>☛I傲_5 rD9,ʬ0>XI%k#.&$ *ʫk$s2:_4ݴXQ^}5~ZZeuӣ^?x=c45u ]WW c ?22(\H(O\M{5F%\K4dO <=d&ֻk2wS (HP `-}ѦiRGBqױFaۃs&z;O@1l܌][`ǨAܶ^[VvzqgG5Nzpfr/drJvUȅ0wPd(pA^=02qKi76:9]4S UPnā1 %vwa8cQ1Ё劫X1rqqql5mL$$pIprqK]-rl.I'p8VZI^_Cwvڽu[ޡ%7 %d.~\1(|X񆟧ﺐn<ł{s[sіl$]Od*8 |ܰەW#%`cq8$ 5կTa{4YÏiW7/g`ӧn{=Z[-$ F FG %GcU~nߗFTpݻ:^@:[=3׳aںZ}UJ7_ul`sv; $8D\fZXCgr䏕XJqEͭޡC*t FnM@2ݴgWTAȮ#tc]AkF7:4H e+=8\],)R1/HsDxMiR`Y,dK"*͔V\U;+]bO*#.ȤHY:; 0>z#Nթu=9|qڻkB~NDNP=r HqLԴ:FlotWMm^2λ\ܕ8#g|[b`!U^W6W?7< syklKwdi J,7 0zb-eӮ]jCtD 0J$]}08%Y`3<)ڍnYks+r aK)(g%T/ M5umWp0O (,{pIr$*[[lm#Kտ]xPP@*!&hE۵@N88Ӄ]eEWJ6XydUbpX8}sMc[ aio:ƏN@1˃@)tnmor 8kU9 wu2qr8`$zS;}*=/uIYy m$Uflaȭtѝ&CY$lW0#2c8f !$7/o+z5!ZVm3+ta"(l ebkpݙmðlkMۘ:U H I$0́ۢXfmHAq $qI#SSsxrV`Xx($ 1#5Ĵa0ͷ9j[{;IkU*!}pb \o?E~y:؝95uuXF$S%q-Tq08ӊm} Q>Hg [=-cv08KTd E.mHGIUnkv"Rе)cEf,#zɐp>śK!)\hvu eU@A`n閷6/XFANF( Wڅҵi`FE][mXQض K*FGZ?\@<] tv7gµK߉fXX%U~Q~R Y_ɢi@U )d0k{-mཿG]KHu>hq 8# EDt{ad*! HfE8s}noMoVZ&E4;K2H #"{cOt.CrppB`KNA}S>/F67U}d*QYW|̊rźZ)Yk'umiuT奟T욿ޟ k^_'Rp Tl B0HhwRI 4&bwpP2|Gx;Ot_Zj>?4BD\u2isڤjQ$Q)WxsH-n^&Vό10`` L$(/ /6%JVYgmmvݬ֧mY}]//gtkgCXH$ ӆp9dj`af>omRTOViGZt@~%NHoQ3s@eqB*`bi=>{o5 x M rK3ՆToxsһ}񰖏JUҤlrTĿ)Uw0;K퍲ģߌc"kY8vߦߪ/3qj(&v U(8BM>B{"oqՁRF%A}4Ue/e0sgY@Yc%pEo| 4ʞc3dU Fbd!Joiދݺ\mFT!A֠~C-lO\9a;q=8 Z;n``FGc'61 pn-#=K|TL3nspku~vֽpph.PF9ں=#7f7Z&2OvH>AbͺVdF aNp c5r"q'Qq]믥Z un:~YÐvV9 ޷cw;ћ #RW$玘1[Xį/!-N^A3% b}WҸ~Zz;_87"߸ g<2:{j E8+v.׃gns sQ8;Jol!rI9\188<WwWn;IPvq0p*;weA`@@9 w\ɬ[IkLYLsd*HZዟU{ Y֎M}>TE`|['%e5pk:" #_-G;ISh,L?,UD%"<A)2Ipyx@_lZS ZȔu!f>0S1C(Q-$2x<Κo=ZXבՋR6īMBWk+ֻZ/B͝ޝi%ۨ6ĉ6b>MRpr8jbSN1ѰWAI]IACk-C)fW w]Ya^ #A²]ԷZ^>]u7T.ky~g_jv}퍊*m V99*Ă6C0It[~!(i;ٜ`H̡{py2S<.t[MT5Aߔ8 .H~-,r398'/5Vio;,ZO-pP@pB8^TdF "oI{h c & #~2.%=!]W`pA%1\+#"klyl'NrpNX\%ך7k+Κ9,r'㓃5g/no-˥HYG9W md2"[7g+ayC*?9p +"| jP@wXC'ۯ{ 5yٺX@Je\P^r҈О19-/5SQSF7 a"E'`Y]ܿªŔm{c"toK_)=,-X䁆aP6^dɪ׮m-I,p=z0{ swxͯ` 2O rumzWV,2\9rWpdw9eثot6NO<`ׯNi_O&K,VD.xJ\}E].(o %C`˜ Uy es dW @nR-KmKO,jMF#De**3طi$67 Ϡ@ۓj<񒋖 8>_0~߻溿khgmL3Y]i}{Ji)\aP7(BsV^-[Le+8$2)T{%ЋG, +\"$rjn.5YKfH L< ؛K@9$ԞU߹}T.kV:`U,P"{p0A$#4OkA0k2`8=H@<p3ïWʸ[V0$7g{.\\Xf֯ΙaWԦi`ί;\a$$YNzZw|OQy[17wmuxAX`2d4߉ѼO.L: %VeZ]{#V x}}oÏR[iڦ>K#܈e`eKv\^ph-[itya7YwwJG%ƵP[Dfb+:,kV׭uc| 9 c Tsar&^1ƛG#S,5]wDCӭ}umQ.xFZUu $>br< GPR$6kWmԚX-ֺ3Y+yl,+M2yr rpI+H<_Z/ڀt~$$]{:Kke-܋|*8k?W^<}x'qku_oIfGХYMm`d9yVkKi闇MҬt쿈^.ؼ -ΰ FLxnZtY<PƯٴ.I=/^97&ɤyV"̝s)GX--͵ޡɤꩮxq<"Uv2B2͸1ZgI}S~w˪FwfFg}ƾqi(#.Bm1U6vhc\Cy~_mnp'#@jݰWF^q ̗7Ka^t)6$i2̒ެ(dkڌrPPӛC'yEFZN[貌/>?sE&V6-tWz}ƌ/xc$ڒti*y1Ubw7nS6_`?2O{9=Nq$A'G|.9cޤeK<$nհ|=c cӌ[ZiV(Tnv V4v|ݞ>p!` :}88ӽk[Oumwڤ4s3 GЅ#3sӧ[F & 1rGuvt'$s0}8#jlG+ʖ1 /C={kӵ]lΕʞWz/j7(S4Y|1a-!1wQT4*q>.ҕ _ږmrNd,4 m%K(g1 =F>aC V>"Ɖ `m 'R\d/ y=9r;G[-r1,׎q=n&d6vg!';;$0(mM pFqž7AIH-[췂ciB`P+w7br8;]_T3)MŪiojMB_%F~AiYFwC:e_!2ːH9JWm;lI!Xvrp qM\PH ~aH[KMi맣ђ_^QL')dp%S;\VվEU:'ɔ$e(vaevck-u =,bQT 1#`岦?(';"нkH̯o?oJܻ}mw:QT(`FUpH*I <׌oPHa@J3QMh&oC0V۽HqR*Y?9Sv\@y#[US趍whx/ J\}?/BElXd1[?*8rSV֜o>d$=BܟgOuŹtJͬSfvv90Sxtv^= }]#0$ 8]lHj;G- [N߻)*ˆ XM;PɆ*&*vY1^}ZVu-FH%ҭQ\1!Hʨ@, rjPVٿ%Pg#¶3j,F~fYd\4˾4ced$N8<|go\Ҟ T󟺡E@ Cl@V]$}M' N3 0T,ͷZ{k+if1bpy#¨ ̤#sYmu# 9>bgv@H#-˱;"Fey O;$)$jQѯAӵI]#*cW\(I W AVIvV4Xub.RA=^[Ԁqqses{f}OZFVM,ܟ,\s:K3i{we%e"\3Q@;8%]i^^?RžnFiA<;G\AڨZr>ķ??`/(v0Mw`Dm2AOgԲvZbo8~6r94 X52iQtРo@Z92B+>ܶvg:pGGuio<*/Ŵ  9u$$UqUDc9$x$``隻+\'"6yNI#<O#q+W 4Kl``95ӷغ<20xR8 G$7`\Yݫ)a)\k8cmS6z퍸u)z+1UU0L4CkvD g=[_߉m f:=ŀ Ȉ -L%Qn-sohYxU1h1QjM T|07l+r > G$zZ=j\|_Cl%8,3>@lu"SmAkK=,j]YFN@9a2 g{trNJ٘H8J}Fמ>(X;T  )v֖\ Kq >S ),r{* px/T`0逼r(%8$cSy M 7`$Sݟsm{N'x ,nOlj\@0mrOR2qk ӋgIp0:1@PvMDFO˚uz-|$wWnmQ L>ȦE )at&XBLҤGg>;U׋|#L7ýG 4#.an Q=}Z3?>6|PƽO~[V]Ohg.w)yPЛO ۽ZjZXEI^]UuwG~5 |]]_ ]mOWK[tJa* +@}qyS')㿉gӡ[ ~"< xxC_GltMxIВY/F /bk;YfP>-!ο4}VE0|+- ۖ \NUh;^5//itK52xvLQoW<3{$p C 3 2i툄k4*]i)PI:X#NM֦֎>skM5y|QR?kK#jyqC` vQp7pK(%g_W^_^#K{L;/;qwnx#YRHќ/|g3߇^1/+N_ɥ]hhx}D6/iGdLv(!I|yh!wZx{x(|O7Q@%ҁ<0h&aS׷UZ[evncqk*% )hrjԻpگ.3D>"ֱxzZ[{*!KY7 oh }8[?>8XAWף[ÐCSÞ%!=y^eص ."eXnPg~x+i|KԾ2[e?<#72I ̑ hKV:X&4jxW7"4\7Εmy'F/ xEFn(ka Gu鿴|wqgak>" |w&pl|__$ַ7hr[D~,!`ߊ~4_>jv>狼?^CoyjInmmF?8x;l Ku,Gjl6OzńoOxŞdGH5x^EfM펝qs=&8YӖ[vqgzEټVd.  x V Hu-[Rigi^"3u߅IВ 6-!n^"^/m i XW]5 <7s"W—Ѱ7r45 mE3Ju/Jv 5<# xX&# yZ[#g Y#햣NKA y *xC[oG1.Bi+{--fM-бRС]WZ7è8-SMk+׉'׼;kUֵit 52I C$N/, !hk)m k>x]T36 ĬX Yb|qdxSՎk/x(5O %ᵚ2עXY%$hst@z?0k߃>'~~ռG4mGK/ l/e+I"4ȡ˶Xa5k괽YTn?u&zDgdyKM+oQUvI;+7gzv/Ğ# 5<1vͨC,,{egر;`3E@" ^լ-um: OEޮch񿜎VuD\ȓ bHF>io~Q@.oOy+"D uBVxROz^uyl[Ү EIapb$`OC2Z0ըJ5uzWmGK{Qm2UZѤV>gn.ۦ]޻Q4ԲNR0dv]Ρ VHۉQZ+Kmd cmgL,ʰ5 [f_.krX#jf*?6MIS8@N]oPmM}NPrv؟4d+}TڒV海n-dN}tNtk*7N} ?3`ܲe pN8>toT{ 0ݗ Q^yz%nuBA[q*12 z iq Ӷ.M+ov%]$f*U:O>L4߷2g~dqrluegmbZ%].ď*VMle{((p3d`t^m%^XajerH$*XJӴu\ѧ/ah7G&UqTdt-:Zm4_+>5ܼ`Xl8ìlP׻[,#P1Wrl0@b&o֟aW*V[[UY3(] 2W5ZoR:XP CT!wcouŲ1zX0brpw,v@ÐMt-hZo!2*F[ ^2 m!0ֺZ0fEm: ȥ")3mw@*+^}X 9<4Fw,NG`' Zg)m5$:kExvTYUrId,(+Jfݯ˺]m]ZMzߦ(-/"}FOua^ UR#A4' wrjs߃M ceRmne-dvY-b! +\4%}s7-|Iea^E|ξ VUI% 衂!ڭÂʼn8ۛ'! HA$A-jpN<<uk[]gUuЕM6qe$#M&$DU8=Q@R .$2j[ǔ@' m$2jl :s22p zdKXٓ2Xz`yݥ~M0/J>bACjW[S. @yOiH2 qǜ^m[: 5H$*p˸ fYKH Kdx^$ ^^\jA]'bK6BJكg90\鮑m(Q8''IH(Aj:9O5Nw8i*r1117$ӁۯjYg~0k 6 t$2ܒ'X銧}>/"SQJ 22K$ K~b;+eɨjY:Q8*4 \df6ܰ͜d c;wgKM_MsyʮI܆k[+닋;)hY 8q d;Ioޞ~޶^i?泪ht#5])<@WT2 1nW yS[ij\fD]2,6 DZ4>8h5$uρ]ȸyx$dU\+|@ǹ @@ kg/d`#1B%ť,lMa*@<(&={Yۑ*(ݵa \ߟW[[rF[?Cٶt.b~Yqph;1opmticaS  Tmm:X8݌Ƞ d7sAkN-?9:rAa6m}hlyv[2R~S rUzҽZaEnlEVr$UjZB\ iIK]&!llt9UwjAY51 QWi9NASm4% X+_-3Cʱ\`+mL.dUE#Wj篵eI#ox?/79^zWiwv7U[/C=cMԬd^[,N>~YFZ`M:T԰JAPq3W(_Y3{ig@66o A'wH_m?d2# +|P]Mt*:yZ t:˵6֞qzbKu=Ev6*@PA%oaxxwS ZLXkzf 0!vht.0F삤 ۫ݳ7c/`Ad0A=U;/cCEmi:l22. ,ԠFc!$Вݰ%W9!G| Ԯه9o+eYp9T589Bm5 ''! = Tփ[Ӯllyj6X:᜹'!Dmܬ[ Ǹ%խ(:l P6[rwfӮȼLvf  @Pp -F8 Z4_0UC( 0R Z 麨XIݷb2+(܃fj o!R\h@؅R6 ǩ]u)bLHwDNdG&OW~֟>>&rGX :$HN,iU#Y I.}=;[__5 fH}ULWlO*1b4$[bͶMx 8ojֺK[imtNx}Ua5mԕ֛~M~ $WV|3]^qo/f[v3 yZ(c2*$?|jig\;xĶG'׈[P7r|=n/.TKCy=V[91êזQ;i |O=SæD Sj.ƲDc O+Ua_K?o~x O5-C@y/;xy[ό>Khff}&ňhaC0kPO$j_<3}Z:椶x7Ư *D*x/r!KQJqoK׻۫<:a9цétޮ;;=v_g_c~0xl ӭ,fb]'3ViwHh]d :e7Vckú)kH|_=vd/4[2K_A#$_hžrMo犯tu"b9#Y5W2Kq$^ٱ)-22LcßxWVxM^,2I:FjQ3V<5.i@x6#O LbDXwbOx7گ_Hȭ.%mjⰁ-V,[TOsկFτ$#ּKAxO]g7K|Qg[]N =mωa:Ayc}+ؖk\'BxwBorWWWz+Pdekuҗ|YcRtr4_yh캳bh<*7Vfee&x.tڏnԴCKI ( B62ygRk$ǃn>u}VGǪ R#8.HL+Ѽ5~:'֬th=ͣ;Ă'y#3 P;ۋ@mۇ$l2I20yogCJWT*Nm-Nzhdk=ZmCk5[_TQP;Hܘ"W2*2@kIkާ7٥MJSF$ڟ2Yv$H@a0v{+^'s)HՑv$TDžRIHZy.x?6.k7SMeEI($,:yleBIiuxneW[j߮G ? ?CDataObjectRef FF\ Embedding 3F\Data Object 63V +``l-V +`` +RC:\Program Files\FinePixViewer\Wheel RestoratioContentsData Object 95 ` 2Z0`}.<<ContentsImage15+ +JFIF jJFXXC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222<P" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?kx+7yV  ޖ5w r ؁RO\vŰ>\tzkW"mHFrℌ$ڣ4^<" 8 tn8T嶣S](y+dA}hv.x?1x!|~yv'>խm=i,0$AAu5U)T$Te=Ef 8~:]cdn3j^CN*)'ju#7da3՝$@zWv}7KKTN29Tc2|288ϯ %-{JĜrª ޴j7_k%2GU.n[TSEsYYZ ԮWd0B>$gnj? jLl8rd`rqjhRVW,3k9$V ܞ$狛 cɣlɎc*yԦ\Jl5;}JNkt}$3e; Y/ok/b as>l R{*K;19ֹm=6? k71K7ꥉ,:I@F :+>Wsmr tX+Y3^H9G G#-c"ïGj&׬-0R]+2gjkka] >5xx3[Qi"W-,:A[ťG}g=w Zt)VLYQ.iZ?֢t4Jsyئi}׭l r:,*74 :~Ì"[ e x5) (T<⦚MݎriYType=SI10 ID=Agfa ePhoto 780 TimeDate=917672504 Resolution=2 Shutter=1198 Focus=3 Flash=1 ImageSize=640-480 Quality=48 Strobe=1000 Again=97 [0] Rgain=557 GRgain=270 GBgain=280 Bgain=392 Roff=54 GRoff=52 GBoff=52 Boff=54 Blk0=33 Blk1=33 FWare=v1.1i OTP=2.18 CC" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?O7QKτZ9Rq<-J,}r0;;/ xJsj/.T>4Xt 7,@ۛF6} /RӛSW(ybQw/{Ӝ!)vVg H9 0"?ӵlvW{u__O3ǴITj-E *FU!Y%ٛl ?Z׋b]UDUH.1>`w` 0Bi!& R7+ma8݂ 7kze2Fy4ƞabyo?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNQSTUVWXY[\]^_`abcdefghijklmnopqrstuvwxyz{|}~]NX,/gEz.i P:: Ɓ?*FbGʫ[>Lpk[K܇9TV BLn'*$ZK;]=5KKKMkeײuj-Ek'7Du%/DO0bE,p0 +DWzWvj[GbTld(!O M;ú]jWrj^Q4 +8D'!,AȐ"le1ei׮d, FO-P[~XqWT$kJR[M.wdx6ѫe_yԼ?MA\P(F@`0bU^Tǖ#n4+@Ҵ'~UdדCEC;F4 #6*H|Qi 'MԵGTbf-1*Ϊapca>D"7I WU BGn 8R(%q:;a/5Y^J_ ;[[nW_M)W][-2Z?iorE nPT(ݥ%X<d' }Ռvz.j2G` Ϋ}9/m 3 BGcӞ9bzku Ɨ%KQ;T&8p q.2NARkyIrv$`q~_J{߉eڲ#8$)w@#v'&8]s`e;Tw NW$J^.Un/~=akEwvK}=i){z0Tc F9\n5;R2Qjv ऐX`Vwـ:Q6ԧǀT8h~h"M3U@A +°`٥˳ݾZ߾BVWWiko"-}/IFbǯTofn(H;VNր/S*HU3@c 9Q) NYW I9/o/T>LD,Kqb=Myp]!t"Ț:S(,<m8 fj5Tn ݃᱌Ik.6U3n8g ffI9vs sdgEݽWo W~ouڂI M$@=8FP,r7(X6I#iߝWP o,YU88 1`Q דlxŷ+9 ``vON0{=iïK};j'.Mg]irXX;>?~,__GMCb"b# Bs0+H8,2+ gƲڢ M$JdhK(򒠜6d񾡭jd pu8Qb0'wkvk>3?g_ݾ-E)%Z'I5&Rw֋H5'dV$oҬss$MɢPHȨwnmѴn1=F5NGtDyj& `).sP:-OZѼ3# 1t%T|qOa_i}m鵎UE$Yh[]޷{M i2<4Ŋ?ɹ h<m#[IluֿGY>~Z^a o4- H_𦓤_|0ҿ|+~1)?t߆^!mMͽjK Z٪{TΟ? >"xDS⏇.|/㯆;Эo|3 ^lKk3ys!hDAlC~?M jt~E\˫^š\_%},>t =K'ν{ٷ *῱IդOJ4濴#^9wtF|Nssha ޚk8fUd RRGPA>Iv |G¯0OQhVλ.oTӵ_Gjdmxw^YҚbzw:׆xrH\wh'vƑHbbXbFtR$̰8ht*'$i r <挓VN-;4\%zẍ́j0e%NQJmbJ5{2Zj~/i:B/HUݹ6 "ڦ0KKk~ Bvj)ѯ< 3^"L,. d5Ӓ2r.eX GźiK(j򮉱i#É6/;]eWᏉo'cΓV~6 8[[x'LjŚޱj:i?Nst2H&<,oA :.kဃKgA^$0 O!289wG{PC]TpBqQBڄ,άdvR\>U M)$PFI;]]+ѣ$|u+ m!jK4pƷwVV[+t"92!qx [Yj$#ݵ0;P3)[|7Պ;_OMf73 Yv8X1VgL|B6;MM~:W5d_CB+*, D΢2ןOoN-ydhۡݳ5,Z{E;HUu݌ti^[Gie0%zcw/aCZíOG(\'-%I{\J#,3AɊiE??ĞK~6,xG~n 5* {u] 0Ȓ=cuϬlĂMD.rWn'9 8gwwyc1 \n^NJ}E;^!5 %Fh,B+CHKk1Iᔻ L;N V!v8=,./v_hյUwײ2`dN91/uhgWeH;Q1 si u yu5}&FlU80yܜv$zjĻ==t Bbe\mrW8 v9Sijݯ~Fzt:[>ƥ/}ee^]%eƲIJEc::!oaChaj"&MY" QwJFEh6HKӜnR ?h N)Mcu5UeNy嶂K1`>cqԱwy/5Rf/V!YTRlBNI|bnp` p  O]:ܑ%a@Wn3X`ܟ6ѵ cNdtR6|) '$1#p9Ԝ7,ܽ.{w?޻kb 7Fѓׯ9$f)8ۃܜ܀O|s\T4+0ɧ&wLaTa3~z#;S Hp1FHf!G'Kګ_Wz{6n^}~˿NKU}5VԇKƧ鱀^W;xb:zVYln1 9I$/NsgHoәNKnQNFxyWjnM@dt<ԊɴӲ $9yVCׁ}k.pq!W X:܊ۅWǪ苿+]lsC۽~QS֫3!zl*6~(~i6ڎ >$+)X|]HI?;`lpK~J.dy9dW|OLJ,5]/^ լo*9&_.Oo],JF~ xnT*(hZ)??W~=>Kd?Jm 7ڴ)$c[AO `3.A?l$S \d'4j:zNtؖi 2 X#:H5_( ~?=,-}=5)nW{ei ʤ#Ѹl7āFX^5RExTJ$8۸7xG5+]>~-:P |pl*sjz=gfhX9,P?\IZnN]+[lˡaOԥ nx*mv#x .Sa.N*y;v@PN戫`RA,@X$ xyg9A&;/x%zVHC PAJ~ké[eHu$7 lF@*/XP0r$qqּ[چ ;C$bXF-ofjpPub 6Po!?m~Z]]kzmSQ;.TqW'[5kYOo鳵nܻQ]<ɧ_S0ቑ "rC\a_ImaaaFi!Ăŷn 0r aL /녗Op]X,p tr鎬")~{DSwpDspf 8앓Z%I=[yOrU٨3WiI̮_-[K֎6x1pXqg֯F. , &= !w;Cc:xUTdh4BtF$"ȡŸU;*F7ۥ<`9\^cr]Fz2*n[u=kJ[K+.h]u+M-GksNHaX`FA$סc`j:p#U_0*md.x;O%w:jQo5  oZM5hgPfcuhp:uexTDpVF"+tUDcVi&{UNI˪mKKMn2wV*qJSl/iP׼?jH\U\a_fP)r<ٖ? ڄƩo,ʯ Yd}q$c݁$`2ZjoH=ĂI qɧy$u-П%.w "m궚d5m8덯.G,.UJ4,Hˋt2? *f5dttV5zڕݕr?3vU%(d(j,:K->䬺C$+88 @9ł~մ}znar 9SQ'',#zҴܤhFUT&WF1k3wP fJpcy|cOO{u+ͽEr8Cτ<XW_fX([heXA<- &hNk6\;DPw߼+*+ UtwñC|H,y2eM@aq?YZmGt;2+ZڷN6ZEwI94iVZkMOyw`#f-Ir…fyCƞ:J p鎏%Դ6{±ry-5WM#_+"d< חpb{7{ů_5gu;٩?v+ZZJ˩Zh7eB8sFz|@s^KŞմwSҴH,Mk} o!BL`y2g Y6C~~jzHWw  6V9?4+JItTkL"X+K Džo|QM_[Y_|RkEme{Y1;s1P0ݾ'{F5ͻBy KQ$TX"KjOvu-Z*]Xptk,dr4ahp|Ѵ+v~;i>a,RR¢VUkZs;u{^1&3Dh-MZu$_6 sqR bT X1X\)5}"BUb$3 yVO{$^SQîSBXIʷ&vª jcgj~1Ĩ4q:JYR%aQ"M}z>:|9h^%xRIYbtk %U`IʋI 8SHTڟ15oIpO:+\i~ APwM7NͷCYv `VUTZP)P (’9\3Wϳ 2Ue}-kV%dw]޲^W]~vg|=~)TĭW:4{ee!,k#'+s5GqJ6^kzE,q\drNJ7mzFdzB =btw},D4oݱmˌ X{imHƆ]:A "rŋ},~Qܚ{iD`٧~y79KveKexER+oУ`@4[g]؍Vfܝj9ܦ&Į?sXh̙ Hf]v`THjJXyNaUwp+G\~ W/װ_zz_~K? /H.[д̮/& ?<5k/>mWSݯmt0+<qrm%1Yɮ+NK3H?c b@2JIE@C|B@V{#"$Kԯ |8$#_*WaH+aQø yo %NT\ےi(]ɴ}4SXWnsj-ʜiwnsJ:'ͽ?u~n/dl($%Y E$U}EK/~'ƣkHne^7դSiAg8Uf4Vԡ.T*3pJfʲ |w1 +dFFyے:cgnW{[gUS5k+mفz=+H&(Jap(; Uo_i޽5;dFwC8*2{nWqF:^2A%Ny ~Qbp@9`TkjZAmZ5;R#*` m֬OK Sޣ,S\K4֚z^R['LqF줌220D?gH3NLFVBAn`&VʹЬ,N4(bQ1bvXg%Y1l\gv%@_ӬoŁ *eG SnS?699[Gyrz=qz˼7bqzs1 IPj%','?1=k4>?CS]:wӎb7ʝvae֋arv!vku&* ^ʫúmK-XX0Hu)0HM:C2JgHn]1~KpjsFPGNބjD \Rp;0'rIgw9?3Ϧ TTgnG2-R:7B !UTEseg5-WT҈(T(*26 rH[k/Ăr.Q>]ܑT|IwegHQ,X[ XrIžƻ]#[._4(],H0K(i f3#% uN'v 3f (od+|6r [QAFI]LG,,o.X_kh;kУu`7Cʨ8ϦGl0zy6d7n,ʤ³c]˳> ]ZaT*( ѩA.7g'x^o,RIk!%TV2̠m#L.n iĴ}5[x2չWOr+i%:wLG5]K-lG?n%Tǐd Acc]K4? }6߈^c{X2$rA ԩa90[*}Ɩ.5f. ,zd $e];(mD;SnfhYPC .Kn'u}~ZM7յkku[d|)~򾶿]j`Py,G nTk|,H99;'aI~GQi5H= eQ]|YI+{50WR|!R`~O|?1qᦲf7?m88 =?xeo6߸@ˮH ѕT(PsvgذEH^"FSn sjC^l2DFYRt[+1 !ƆsuV}<~Ckkvʪ$V .\1=io[n%]3HҝF28,켂CrFUgcR#M)ʮsrz1E4NKL'k0r0`@rsn6}NCEnL=gOTFOU0ʡQI#XJC g$eѼOu64 m(0ѴfEX]@GΜlH 8@bF9 ·c9ۧ8!nFF zsx*ޭr/5f:Ѯ;o>WQˈ wdE_3s$n% XO ,.BP#%X7vv [KPFqЅ Ɵ[&^4A!呸.İ 03 UZI7hek6[k`[hº@5 $S0TF7* H;+=[Ju5vO<A 9r7I>d( q,K[<1kajiRt8ĊYUu6JT&|I}]m'8 s]v3N=1{ף .n 0( q999$dsl- 4>x c?{٩4mnϷY'dTo-mTtIYyb/\ ` ?wqm$` :kP.uA%[q%P6s `OS9|3;qSrT3'<}謴 Z~~vX݀b8$\27(CaA$8ϯ-:VGurB}QJa6RVdpD e<|q1&:ۧ}BArd̟2Z՟*Q痚"g6J:Ȏ1+eW*#\,boPޡa8XFX $,d\.Hk˻ۭrr apO[HӑTXً_Ums@^x`@ڶk^4n.ٴ]hLڣf) C +}1]AYBppw`eq#s\}ޭayr|M>y9Ma'!P2x]^:hRmJUmnG \-!^:&0I+4^vqvJ{W:YjXjA혐6_p#p!8%ͬxliE By O6\TP8*ɜ'FQ~9eF[sg#ic]j;iye,ʠNF>c+\k-~9>y+wOFE5zf". bቐ)Y(Xw=͝m5ʯ;A9*c>Vmiݰp0*pAs N d +7tbr6ӊ$K{ƏKdJYHCl(򕉊pHPH\g ydSb_`%Ur3W9}}6Y"Dգ:KϘquYUB* l o5T|B#TցA&Dž$ѷ@W< Fݴh4]ݯSdOඩE^tX9+n孜mf8-VdKQ0Wr=G[5B @}rRQ݀I!d0~ŧ:t:>ӆl+2`XH';xG_Jc$p+KDKtg/_օU,Ymi_g+rU@ziWv!y-sjdR iCSPxB'U3)+ס1xkwGKUaorz: w_(i:S@P dzeP7?א[^7)1:%FYT>TndMm:E<<5mZfH#=K,J@_1<"w¡Rk̀o im6ZI,+vBlSw叔bi^um7$c9(˖5:9< RrNgF\|ාxG]o@4(󭵝2_pi-jpA{jv:1~^I>JRռcx~ 57ħ#K O_zM'(QYڮPOo,'RsJ5a ˿3tǟ٤ 7QP=kRrYEr;.ӇO53+8Y)ӔZas>Y9ץMBjTi* s'̱y}| ֣W3ª\-HNέ6dU%U[]'%>0toN"pŮ%4KGwm-%)T.4]2ksiE?@\1AYYԜ$3'$/>Ҿ?iG^$53Iaw\B3È{v; hK+F[zYO'4/q+9U,D)C~!Jj-]Ku%USiNSsҌgKAmIӓڣ̾ ;EO&#ĞᫍV0Hu}٩ 2WM,(KϤsjH|QxARn/skb?I$1B#v43V|Wb/ |QD>s-ϋK2kY]ǎXU#Q)|=2H)UyXI\Xʑ ̱$9ےٯwVVNkymrv$Z,OfOml~Ѽmnu@w^LZګ/!y@2G3DAܕ1"eX]7P+ug1L~cV$XGu%t&20 䏺NqA4.4<|:pAcR+kh_-լk{nM֎rI5'6XJr_.g*2K寈?<)X oW[.CFRK;Upf`c:Ԯ q~&"09I)xM>&dupX v>6s06I1MMƗs$VҥtvTH?3 C6}O+oڽ{%VwӁ0]Qmg5wdMuW[^xH:x)@ )cHAw '#p/+t6_u%$cCgu#aO5/O֞*ǫ(:| ;BF ._9іW h:?2B=3\%Uڒլ~ٛSAIINU:vn/)5kť$d&?K+M kWqm>*\ʅ1}6H:X0|Bu?<<hZo%\kw0\+j_E^f}"& &Vqā[dH"(.TY2$oY+<3kZ:rV Xd)7,R?k +\ˉOWR1{5NU\cx݃nIX9uK(V ZpycR:;96ӽWz|%7z/9xM0Ȳ WV  ۴-Ѻ̎єƂ0Kq$RB5Y:2$0c^X&3GNCEbMD59p P9z}:h& d;12J +c}|_$MSR:5bukuF uNF+XBK)!e >]CZy D1ܮf6DfP6p€M7ZkNh'ˉ)I \fW:_/iOTGյ[.!hZ_2kI\GRM ~t}IT{XYe$!e@w_jپWn~|Ui^}[CCI67.$-[N fL(̪1©OZ\}wC xmg+,щ#D}(F܄ɫoN5*)b ,X8vb05ךi !Qh 2@>;=^}uOYA}sǍ5 *EM:F%b|-+hh $V0[ Ϸ>?p/W$@ 3a^8##0]+c ]%iqaO)vxW_#Ml!Ay+2_JVos'%ӯS%i=avMA*7̞hrIܱ.ҹ{qsyg:ѣ6f$.(!e@̮RBȯ$ ]9Ʃ6tMͽg% q!H{ZK+_B]+?^ Km;P|eiƔG׆8%l3b#I97"EBc񏆵mw?G,9Kx5KfO21#M{-Qp"_롵5ѴK"&`Ċdl9nSҹ߅?/xN$2_cp =L$I#q qО_ie^òn5 A7xN ,qqraگ!Vv/"3`#*[hYe<W{WYHEoxb887qG^ m7/aA}|#;H/$X2Au_?:~f>ܰI"F ! 6gx*25ja$.Wf1T#x(d:/?~`ymݑM<\$+O '<ϝw5ӈ܍8yN8$TWT4nA oȴYRTX 0H 9]94K7m+I;cU7; 8 Ab`% 6q$ҽ[Y;մ}>VyZ_KŧNz)쬭^P0U@%hbBY^G9,XKƿX +;({WvNκDrB+3E!dvh* RVZ5Vf mV$. ;HbKo]DۻII96,ʒ1wjNi6-l"B=9v20 1F-Yo/,Ih{c }] a18# }mp9sbpzXw.B@*x moszyir*wq-|Z[鵏?4x[:v2:0CJ$\5D/4 PF an G&[_ MTiɌO22_y! g UTaz8? أw_[3;[}]+i߷M:v+iv6nUvwq(Fs8]xm#':rpw#9rθb{utT@`v;p@˱x.=̰{ۗL䝪ss'8\2Widng}mfI&_9#M4tGA,ry9럘 1-@a<SZV 1X2T }]FOӴF켢\(bUScʑmG[I }ibO6MA[s1ʷ* >+_StvoMM%k$.BUWpl8m"M;D `$Ӈ[+D,\,!p9Q7UwtgKFan#'Nt#i64QKC) y[Jp[4_GPX hVV pHwEڸ  ]qJԥF5T,Qk2|ꕘbI7?c$riʥ4ɾzEնW&˦GݻWI=mxЃtEQX:JSb,Ғ$^M$:~֯u"%<6IVR.*1V>kTaɍJuᶳoV%̬Lqy$cC 3 Z9,Xx'Z}?~h@wo,n@8VuDŽoǾ𭈄Y5 at!4Q.,H*ܬ|[2ڷŠk7^[nUyiERcۮfHvS)n \~⠟,Rqc)$IICy6l+qI"\ӗ*/k4TN<k}Qc iz< x3 ~bˋuW$x˘xU|x!k!S[*#{ yhmkXƱ:: !~<l xķGoޯa<|3-[U|sD6[b#0| ~ ?fo㶽ijʪ!`QtӪ1'Vd;UCWf9V[Nb=zq:|I)F1$TiYBf?ZeԅWSH=ѩR%*j7)F:)煠ҼOhSj], I3kBҲ;eGmIu{?|MaS n|H一:G5Ւ[{d 6)Yb/ cO ^ ?m&]^cxxme-DL`-2YSeC2A\0HdԞTdT^)ԓJ-F:}o1Ʃ*425G%mBK* ZkQ)|/)'Sı? MCLy? xV$O SH!O8/] SxCE?3j ngHX-r̰[˲:g|; @WFkXf+aU ֹhoΫeJNӼMK5N_j}jOj ʑȇӏ`0p|;;7K~K8T9ToZpq缦yu*k҃QR!R-J凥4a5isͱhX&"Iaa}I^U=l~K+h~l5 1trr)~a2Tc4ŦXjok:_]$>X*a@U%H(I mzn n)HvاFjjZw h,X@QKG\P*澗ӣZEGegm,n̚iw58+ J;۲ xTޅ? ܔ;ʛaQc&A,d0ʰ.6p+Q_ X?-9ޑzI"uVXxL4^I;c'SG9*0'[R?0 2AR\U^}R& ë )XH̱#9I$ ľH+J]UDQtDaBN 3$$_֬[^].WA^wivG.Ip̡b|"JVH ˊ7 t}vVKWO`̚/+BbtNP;yS@l?zVm)˦h۷#W]ErYB 6rVz'H՗1C8wR,>OWo}9qWGΒVQn6i[+Y[kZ}EUaY\**K$qI"FU@e6ohg˓B*fCed;Y1*H鱙\7vJNA|SPCʨV۴S󇌾x^*hC zlnfn\?ױKe[{sm,FFH'`0szf.ϳ#plc*98RN9r+^ݦFs!Wu`$}#Bjzw~v`qx0+./L? ί16X Nr6O 8$sA4dPKo9H]Ԁ~0\c*s,?*х,SX>Fs0G#`. ;XǀO<Ћ-u;>s6JI5&J9.#VErERZ,>99\A!O[Cd#RL:+pzH^\ cm'ӚWog7IoZnHFA'8N},k:TYu -v!2PX.g+F_~ Ḉht?Oίj>K9%dA%Ibxd%GSF49*\;`ܗCWMoY?>0}X_]~9f>!Cn U #06^~6Mp5KN)hH2p "iV,##p6K{]^\`Hc9 [GӂCWos`9WeGM5m7q_Oz{5{j;Fꠍ~z`.mB1(b71#-9$<uvؓ<3~ Fүߨi0e;P?6zuNk_7jt{ ?oZ:es 8\؏Y %~TtL`|0wx89)Odػ0XŽ'c$_E[+aq;:NnmC--b2V&R#rWv\ W庳~j̀v _M  rmZ,K+θn-4gi[#񕄆gfKn LXXm#m7M}U;TTt܅U!Ur ;B5cjFcbݓU c$2d[RJK7M5tjgR.RQ|&Դvm6l3Eu][V΅.v4`Sn ugY- COd168mFJۛKÆ88 dP;J{vu .+lVp_lR\H8۵Dp)^ZoI;]뢻nE]T+%N";@nH6΄u{k h]U\2S6((#kt΋hgid *B>b~һ KGMޕ5i"іm 8, u˺{~n޽Yy^ZfMcMLePǷ0PB1b~|0!Nֵ95=%ρPXOHKD2buvu{&f2jŶ 6i/>߇cxJa5@aIAW͇:.ehRxշ!;yDu G;o}ZڳEwuYI7>NhJѓ)'9/z?y"벍 PO݅-p_+B^]22i;KT#nXPJgrF``Y\YQ39 ,1݂eIU{Zoj4W@JʻXJ(ݎ1k5z7OQm[evmӫo},trKC .]Ab$R5@f),V>:{xYuhhd6CrdCQZ׵&\-F2Zð 7Xl U Vnr0<%+6ծi[k~W0xd\ֻwqN..vK[cifK+|"iM2s2T3W$|dOxYPF3d,±XB&Laj:7,RQ]^Y54c@Չa'EB]m}P#\_0F%#˳*έFtqrǒ[-VDpti*0VrQjRJW{ovi-@EAK"A=Һ#:mdP􅀮b~pBuWg'%P7@厅Dž ޲F3Qlsc)'_]5edV3H={jӦ!%w}Z}& e2'cϿ5q L(t8 0u`ۏdY 6d4,kBbH'Cr-e8,YwmJ<_K~h6ko}BOtʼqF. 3vx%[hF`xlpx?XڌeZRQPQ읥g&/1sX7mnw+]\b/?Η0p08 9`#~J..iY5[XHE+,eC<{<ϒ(g?ZQGO E%?>)\xH𗀼 %A_^%{[vm U1~!l_MWXb kׅ(Lٖn嶷_.4a␛?y[ÌLO/MRty騵ܱ> o&)Y&rQ<6{J{Ikn*#w]GQoJj/8O.Q|!:\). mRqn?e_,ƴ4~"*k4zu8O0,X^M~GxNwkbot_jNǟ-{nFX]3\u ˊHk|_ѥ^B>1|S?eW/!&/lKep#-ap1W[\?fU&W4&sӣΣSi/uI)*i:RrNIb]Z&I׽Z3*q}nx?~NxCZ2|ZӮmWw-,؉ b>sW~SZC;)&ƕ~ oė~#[Y/-5zKȆfSݷ_C'nto<[/ {Lh(D$*n~-4K&I]&,6Z 6qŶEEB ѧjEK ,/`ex(+O6,-^]kz’[=#Abi>6|LempZ? ߉u[k+ՇMӒG2\Wmki:ׁ5]m5=CRu]cZ5 }=.F{ &eEڐ^jY4ѦV3JX dvU0d2+nu8&gxחWcWxX "ILJrUw8B .9ԼjV%MwZ{ٻi{,%RiNJqV kũ:9y;Zކڥю-KK@UH@EanX7jZK&:]kJk$p9xQ3H@U)FGeq߮rkX#dM=畺ͭz\,؎N`@rF#37+.kg'{i{YڶW :;?cJTe%R|7tNwLY;PҼ9K"TxɌ2TL2:S)kuSAD3P3|ʬ;N3?k !ԒhF„TpNPʊl{ó݆q/N&<~T!ˬXf  `*RV]Yl#~og+kJ0M\Ӝ;Y'sϭ5,#4i<ȥGU 4RV%bay6PkzƧpi-g.|o"|PM Uu|qnEjM>Ǭ*y.Tpwfn]5$E=/F%M?F։kJ8mBHD 1[I,`Hm;f!#y.$M7x?:4>#gL,,TBg6\0e"Te*SMq/2I&6 wR2SڥxI8TmNe-Z>kE(seu3ԙ~Hr&MR)Pv3[RHl<:XnmRIz1v7 o^"htiJ5POSH60H\僌6Ew/SJ(X;+ Omy}'iI?wF[Mm}#4EznKX+.ݭgŪ[Sr '$VI|JGMQ4[]VhSG"kDN@PXyY#dckCww_ٷo4wEyI0xREdԺr!IU0H:枃Vt}LBHv3MJ+mau[˫Z7p13>EnX#Jݚӵ5bΖ_}\ +2f *X;JūмxK+NSJǪ5,e9B.T\Kދګmo2ZtZ>.}ㇺշrk&x丳s1V&:#WQֵ0Iv}}|6ͣnglx6ڥFTό˴#t,ѧŞ'&hYEà&g:d,x位.x 4W wjKEq$jG4+?C]-A♌I,["IۉS M"pfDQ~^enTgȫ¤<oDec**VS)9)aRn)URr֥Vrʜ5otxbV-ͬ-F{]AHc#oH/=O-g][iW44a !,HaBIKfcϰi'3k^$}Ǒny  j3M*F.ЂP#()cvQ\-b9RqK3rI\}3P-eiZ%IbUlIv9R[ֶy߇|:he!@rc `xZ_daH "S `rWwcNNI8BA0~Ptls\ 8ҦG 7})U*I \ŝt EtmH *oJ Ĩk mXiYTϢ$(;63++]=MkoO/rOʁc؀@^BQ0[1{sV NzsT[4;mK s:m#`Uzo'7ħ\.R n'w7J.*qӧZbTjH~^pG zMފo_TӛMtVc|R 2[rb:@5\Wyyz;oO$ GN^ {qY֗jĎ~R< z޴~. $N9}3ؤ2hK(%I@?"`~Rq [[ȳuZQ#93ܞΓUe \/l͜ !? <}nc#׃ۏAШl=5u;YOx FO#ؼO89$G៱] BR:mdH)>6pˑZBd1 []_kӪCGxPv22pz{u|?L~'hT(eOpFWt{p/o ap2QV͖Jry<>s4i6'tj!~'5mG$~֗I>iJ;4n20FAGa,/fǟH,Q xG]b'hQNycXZ%}5 !@T'b*U0H& rSޮ,T127[q< {/EKFDT ~X1DYLc ̓yέUZ%V֖{]DӬI!]hk!fbcU ]WlècIg>;EiI[^EY.Kq$ ;&/9#68Vo ;5|\*/~ǾfCxfi>,Mg5äB;pɋq+ko΃c]1tx\3qN\– ^`+UxR(p,)MF$^^i=m_65trnUKWfJ..l~ݦ˫h~ |GvEhCI&Y b%Dfh`я@6ebXI*~PH(uM(j^}d#FH1Dė!dl9}#^gjh+Gh&א̐! yvݭvݖi*mmY^\+ݒW7idc$ Yw`Cd,l۽6Q:у?)d(bMd88ua+j9 +BrV$q6u~ko_iM5T86bdv}a1#3#@c haxYo< ҐCa򀅙]FeFĐIޱ[e `Fb3TR;7|Omwe_Byw=}͆[۝SL7WbXK 6ZΣi&Oh|\z371esºnmlCEA¹ +rXn`XB\);ɽ,M-$ޱMFsAJygzn^\f䜕dU޹>C -7Uқ SZ&ߵ6<ė`Jµi} +36 31an0 ٦ZxS{95=&Izaܬ@%AC8`]5ϱxFt` bˤA3B2yIW|mZ JW}jN_ȾiT~iSN^͸6zxA/~N{}wI֣iRX+|ÅpVEfVDx/{7<=gvOxwEtxts|a%,.$ UXdzY᰹n~Q,4݆$pzYM/VIмyZx:2\VY|D$Mt ]7Ωb1Rqn:n3qwji2r IQbypjьhN?u5W>hNah/ُfAi*<qȒB"K+YxR6>biD^d`ݙ p3G)']FWmb_C߉.vѾ ivo.!8uQnc[s2ƦB')ڕ; `o!K+⧏|)`cMjHG5KjAlwq$ʐCwg( _Ҧ/_:q9.:\F_=,Nc  c)SsQBSw8 gpQ\nJ&uei)@4mۧIUʯPPU:sd18ω%9D~3񟄴!i<9FڕBKVy2" aKeo{OGeGEOW ,sC jQ{k ^Hl n>'~~7xKt__?>1zw[ƕ[Q6i@]!M9RM>7xQ]Ԟs<5<~l\YS⢥/d].n^aÆbWQVg^JR jRWn4\ije?o"gxPB:.gguGB W^~FUeSYݠbҾЭ-3I|+ 7\ʈE-Rc yy cdխQҗPѵE3푒0pJf&`ҤJG=uCĚNVMO Jnxq$."?q+O!i3L~[<\YuIʥJx6ү3qe)(y8, Zʚ P!N.Xra(VNVX݊Yx]-ukxPT6u ç.q1<5yNp)ldWaɨ_xG52Lef1frh&c<%5+>~d՚|]u޺ؚ$ 80oi )J2qN2Oej7&{CYE-.`5=ʲecHb޲ HIv֗x8IE k$.!RΪfrE4 |Jѵ#>յo1y^/Ok_hk GլuaoP޳ezkx~]Bi'Eet5j[Ofg >L>tkB1ƮPWQRҽyjOq<ЇiFN%)_S$iΛ5Nq.j^t\Z 4u" 33Bm2&"])|K6d՚Q+͖b9;T*QN1V/u=k5<[ۋoPf I$(F2ڸPſ®_tu<^R4}TLm֮fi|6"ņ^=MzN4ݝ)y[i)˖ ɿuW(<7]G3JBj9ΚJqW^x5:җ-q$r|9tQH" 4O:>802[ٚ7ptGE,i@3l[y&jq٥{i}_RL_Fq.Y^cQ%hʣ^HܴCMGm]<2$/axd}Y/<+#|gZF2H xf}@'9TLږxhu_ ʹMk;T;=ו<sT|O,zT6:>*ѵ(ƊHY12L"|Digú%mewRȲ dUV.{ q^؍3A<.bDzZnvY!B_#(P7WAK0Y63k1p ,0;Ng2>r n0U&^7IYi[]ㄦ*J)T8B)Oܔۧ?gVQ撜,_x3/PU@ FrRq6gZW#H 'O!*qqZtcG1k֣2D)ew0e>hX6]WFj$S6jMuA化\AܳsN~݂H݁#3b@ d4q҆|]ryRY=b[ K{OKWfn[VZ&:KK+VM?$f3e0f$n`@|dXg8 4=A IߎqYw:м$,ώut/i`ꑼ{νn"TfA "!\C0(1[Mȷ[^^}w  n8;0x?*pdc;Nڎ\m@cTg_-#,0n0Y2݋djKp23c @$G5oM//AT7mB`8+~39_?kF7'1?FHw?P.I *mq:U 6ۗx _ESf+!0 ʂ8$AatSX`9zzc4`lc  y qϡ\i;;)㧷t-QfiZj6#L S09qK7_J Xvܐs_@n21p~EQc9-MڇF;n )p'8ϩZ36}U(C6@B|`E!!~5\IqejgZBm$,me!(%Xl8m}:RË&H$:Uc$ʡdq';WtoWKJMp.<%L*;_Kf3e'}voy hZ;7TҒB$ue(bC V :A0+#&х>/˲z|􀱝iY@ -(3Kj(Y&[+BuT&F򃇇hH ɵ0P 4?N9Hַ1'NćEقwvgNs]Y^6Iii'yBJnY%vRŅr`11Xl'{kU൷u]TUH8|y珶]7J $ފ79zXw kZΝ3R}RVnqʞ\J-G$mV\®L&%Y]kM][tdn2nZ$ޖNq菪i{+u!`\g#EsZ<⒚ 5B0v3IaiOj'~jV|ndc&2b8!TH_B'u8IѴkC,j2tD+H˹׆|=0Cq4ܣmY*xnwi7+;yfbr+9rš/,y}]oEmRў#h}4wj#@…W(@6sOOߌuM`qy>Q` vO`G4kORX& ܯ0 `Gsq7ׂͧz֕ZBCf!W.?ճc2/&#=#FJ.pxG.4vO>VSm(J*ѓvN {}x#e|;xbYsm1* eqֵ+V-|HGcA(u!p˜_2 (C)&\4Hj$4f-6Z5 >? z{eċm_)#4di=ns_>eOܜ<ڥdPX]5>mSK|'s*`ݬ dSjYI9i5@h:p"H,K-#pǯWY|"GƟKKn;aLcP )~.u7#JҼ1IiDR 3"\|)[ Q?٬5*>_jɏ #,XJic6niZfwWqwW,qEhkgdTWJ.G@2 fOw-mVeg\dCt9Fec/,T'J z5x 1Em{6lMoQwL $HQJYc+-scy7fA7ŚK;Ʃs2K(_f BaO<1p._jI4!եm{jn'j.Tڲ楣{G+| vZ]2GhOv;}Inf$7ßi6vw!  _`P?zY98l*/wnvxw|&X\[af-a`ï/?3]~X-iښ׍'ϬZY먬Ȓ"YgʰF`U2(d+1SmQ' %&dZqaiڞ6k1tV3e'h7WG|`Ӿxoĭ .S/ ϯV 紸 xdhf;j!i~p[K1Κw~Imt_9Yϗ4im )Wky|#"1Q矩g)ZJ?Z<)YPj:s$Q1d!c"|9Z/Yz^Mo x@2tֺ dpMŮ# +J>'uЩn'^Ό\L&u$tA-*m&U%.EߕxbeO9,./h7JS4w{VԢK~?fZFb,"!Vax{<|Sq:FYFQSjEB;~㺐r/ Xڊ&7F܏dRl̋&1:Et^j?yhTA2Ø5%?y:1f8I|mWcOP7g&IHY\HQT7|^ymg+[ KŝbP9w%"llv#ųIYmekK寢+).W{jmF}<465v!z!̏Ulv<2,ƀ4"%݅ZԊ́8ٱaf7U*˴v po-"V}%1o-| iY7艦ц$L1hgh$A1L9nmcdN74I*88*KNyNp);Ԝ7O+;,4RIIRj)Ti$d`sMNofOV(33c"`M#UTQ01CIcb'Sκ@OT> xBMUԴ]94}oVEy˕ك8vco8Q]5g%ԼI|>&jᗃmm/OzV\Va, x$W-k0SFF0 <I|"Fۿ[ WV>+J>Z\C9O{6H}75g<|V`ņuZCjIukk`%Y][bq_fx? >x!{~(̟e?_Oq+ʱx %j $s=k=?g_G5*XTQJTk9ԠӒIUSS䚔#*9m S5/u*X+ciDULRxz%Z_aym47Aȧ ~׿7_&Vރ2R$Լ3l|kinuTzm+k d[ծ:{cx9~XpN6XN.Rn*4eQqm7%.IqU,?+|aenoVU.mZ{v~qxݿj^M~ ^27X֤GS4GEgQ/۟ ?#,z?m_Z6-ȱ@6`YJ|A𮑦^ؠޒ!_+}7/gq ^wEѽ̋J4`He@ +|'fܥDŽ&|u|aq▏)m,m3"D[#m8ؚj+V nT*J.b-784䎗j }5l,5OJpvV}=#O+.ß:h[ğ PIt,i[y <G COo,E3ß|scc9<s~Ϳ-3h"©-ī[ nV kk}}ۨ|1Rkf-Χ໋%w6;Ts4lÃnIS Ȳ8Xz3 ^cs7)`b\ҝTqw(SQeMBOk8 8] ܖΚ[(ћ/3T9^V'ENnqM#~'VZhϵNSE-$rědra`T0*ф*jhh}aSh6a2)[Hʋ[@Qfmɉz /~{/S$JAcC@,UEU0vj6k>Den[Λӌ̬ӃhWZ2ʛX^d49sSpwN֚h~Ke4`r[P@g1b͜0OQ߅8XmdpIݚGXW_2 @BNz lܴWL5k25U֋ɊS!=d&%R6nZ+Ƭ^# J+ѫ\R;%UHs'.qUfR*rhBn)ԼQVmSyv$mK©5͞ȇuk !KgDYAgׁr]#v:i&#}^\4lQ[OS niZ(ȅ k_\o+-;KP4")'d"_Iy,.lL&xVY5k!@Qǘ|Ŏ%\a2F 2Vr;;NJыR6RVqy&Oif~ Ƶ j3Ib#)BSURV%Q5*h-/5;յkz&O!KdM:fF.Iᩮ|33vD`1pd'敖I>ucxgLu8R(O5+rCn$fH6P6e884|Mi-c{4IB~Ҝi){hQjJo8' Qfm_jzg%7]vr Z32Qr 4;E"\(X$6\İE 56c-bpay۽j##b4$ kڻA$'+  +{$_1bBkxSM,ʪa컇麹'xWeMJFR8ͺ4aVi>Ug)jPV,5 rΔ,$J-ԩ*N\/TjwW>/>2bY;9UHJI)wC᫽JXie)4"`sMXpn<[&!E2 Lm4u0coY[cہRP$m %;O{=O4uTRppqjRѩJ3oFOWtܳ5/hzgk 7\ү])|l7.|`Hbr@e&|/ dMς5)g_}>'e%f8*G%-݄҅7?-ז mUOYbC' (.!@7SlӼ1;,̇-Y~ S?uMaYs+[;2go$ñ쾏jZu'V3&M)7ʜ(pM,& 8p\eJƥ)SZ["*Ra 5N4]uR:FW4,3+4I4Qis@Ygz}/Pvr㣑 z~D𞗦 Q=B񖎩/G[Sz6l0ZHȢge ^cCK".w`‚\A8*Jp7MtqjKXi*ÞRTӋqQZ6ԠFj3(+ >lN Wi\FTFpÀ%5_+œ˅eqmDO=ɼ/zִH`Ss.: NtWz5^f~|S)l.1xѠD0|%@l9{li}]M|]_$f/i%I)9Gsm/ZdOP0Nry3Ԝcc[.!P6vJv0j`D_:3w,xPprrAq7msjn[oܶ~(Xj/ۍTpJLr;Mg]3sm=w5^ڮuxV]X$> ф MkiyRFF.lqwFDD!/;c7c 1z/^U pZ߶(Q@ ͚-5; `R:1vS wsL_nq  nm2 ->KCjͯ 1v0A-$mR dc9@Rݤp 0\d"ɰJ!9 @GotQHXx1W s6joxL$\F4P*\D<Ѻ6zc[e%_uzoV}/v%sίotۻb@`<9RW0I&%:Bs:W F27{?.3sJN& F܎0rap9w75MSQi5vxfgPT;Wkm(vп0\9/Fbt@8*\]QXF5QST+g2@8e <0OO?}ϠZ4z.izZ]FU1 @|#gU2I-oEmie(.& ,gJwdQSJrqm5 %~j<Ѓjty\b8ǚQj&xu=#V5F0dY<'ċ0* |Ufi"`,nMKn,ʰޑǙgͭN GXfhkf4!Čp''^Ѥ|+W5ٴSFȷ7>a"唺P[=?+*1pJji'St䚻yV4kZ҅'.wUm Wo-42Q?W> g;D6ikh4 hX[Z)}NQ+wa fǾ,~{Y[/{{\jV$1Z܉bxoZ8|߯^TyRB d`rWBOth a쒅8[nPt+7$ڋ&kV]?nP/׾ |m>'i/j7ד|In$y }BK+I$IC,/G ]NxDmSj^{9(xgv +9՛2ˍo @8 xT##k_fGѾ8~<+]we4^O|C7l~ռQe|e_E 4 Hmr,FC DV7ҷ*/ӝI)'v8jEJ*n*Vi(DV}ϔ|jt"O_Lt+j>܁,V>ʶUwK%+# %пcº2ZOJ = D!t{W,TqtJҿfGUmx5` >jB~W= r@u[o=Ιx6QFQYh%yx7kxlC̍wE;?Ŀ?nۃ&~4Eo R'` 2[j%0"_!x]ſk)w|aퟞ-ėv:3FL\_Oܜ*S^NnO4{]uOůNRZn;䜜ogwz7k>cXHlˡ ]lX'˸FG.~x?g}*J!{K.NM"1I ev89%|'- |~^`{O2!̪ZGO a cH ~L|*wh'o?5[kw? +Mgcaű:ΒZe,/-[Z[jwXxRŧM\Uz4i:s]u6fhJ>c){ISWkaC𱝔Ɯ xՂqVnt3%.WzT oWJ4I˼q4rܤ |i f~!Zj~f| xk^ɦ]I^Ḏ$K0ô^?l,읩iU/ťZxCZF\-'K)%YP-kwHED w/ jvoK}Sڎ/%b'4[OKXBKsy!ִ^8,|fi, A/O)/#y$V_W{iwȴgg%o)_¨5O ufY//k xJ;x𞪚 oc<'vEhhya9TE«r%Q[xHj]{zQG0 C8>fX]vI~:&]/Ԛ?x4 y"ž4I {Z[;4 8kndF7R߂F|;3()$[8\ܲ#9{¸.,2 >#`FjMQiJK1䒌c >iK:&}`pt3II5*/g05si^~d\^yxx2#$fL9g|L4- Dc& >bY@?r:r hP<6d1>$`>1Fpk>Yu[XyĤVI2HD2JP1BE@+dyuN ϏͦNm vRJ*T&`d?1&x{8N*NrI[vNɶ$}xǺ_1ex&=0.Hբ[voIrF6+j~ܟlhh&X1x~.iggG/C5$_iz&totlw!7xaj:/4 ;^0}Axm Fuwc-̑iv|X.?/W uVA5w'kxws9{ksᯃ <1Ӯ&NJ5Z7w?[-0#ψMIG2j.*0V;IL><3rRPRRZF*2No^,ks<'.|kr&i<~|ADOjV~'u#Үn$J_Ig W_/ODQq~-Y^ŒxNúB,e>+!wqq `e}_߰Ofho7XD|yB\^i}kmQĚVg y5kH-xztgĘyש^8iBQJ8>PNM6eQMJqv,=)`:ӧj*FVM-?/[G?_|/@gf#7lB G{$`*5mn~zeψkRZ^exzv@/g??| /4 ?5KZ_^OZw=Mk$Q-e䱸/W;?OOx=SúK{WfSٮ#fC*,6V~RoqmĿ_7^o ~'ӍF}Z5~oN˩ZU7 *c 8-~w9No%ڝگ .'%cHt2Kis%Sw`'WFq)J+(ϒ|ѝ5Q-E&N:\[N҄#Ri$n-M;MPּ%ipt--g3S~b_?L,?_k,v E𮯮xr9d{$$\,$jIDo)O5'W|QxBiqhtY;5KhH.d}7QAgŋüv29< R8ztM\֜kHN״4JjTUZrc# EǑ碨J2j*vH3~K<=j_:Ή6?x|Sq+g-4# .ҿ)Lykwro7Eޕ)x`|B|d$m 7^Re ީdUk]߆K+q̿hVcK4Rww(kvŗ$/@ ,I0^νJT]eo&kASWvJ¾!S"U6i+EXy?g75;okywOI)݋2Ma?eEQbo_6Kze1,>"/}G᷋lξT[܏3{Eoqy.mi?Y| 8'Z}J4@TeT, b1y6VwjN2O-n2̓ v8+Б]Aʶt_= :2ES+6̝ͧL5wwWJrrvzEZIWMOIπ|G' u[a:U>> YɥaqcqgyxMGjl/wُӴ]!t8-5 B w[ۥkVvPͫOoڴve iyw ~T|eOo1F~zn_ÿ|a >@oơu]\Vv+fԼ0l86|*(__ja#ďυ|e!7t˝M6:Qvӵ]&=\F*JTcVK ԡ[_iFca681Tiswtg4ۦS<ܲNaOUuOxW&=}vp[ɥcuyT s$_2G+MUԼO'^.,?uƗhI|KYw4k}!q`_h:XƤmQ5:*f9eS丗N'.NʤZup)Mӕ(JМ*~ߵiV]M=Tv)*K,컣g%c1PgxIwW|8XgO_QdƏ"H8X<$+ \F7M;='Ou{ Oc$C18w(ub|q^?x=R Zo[YhxU iȤև\ As tQ:MSTn)FKJX9JB>]ݍͣ|?Nm5O#J]dp&`% nS*E dtRBx?1 O 髬IL%I,øHZIY22?y%dIku-bF| [I.ψ.m"fiUёg`.ff&fo/d?2|Oҭ\DiUQTc*'O7$(QqOت~.Ln3'QߞTb4 Tpo٪{IE˙T%Q<\i5M_W|{^A}+G?2)[>2VX-.ڭhH _14{Dn+6b`bh&O!#xIҴ]KX}F/ /ҙeDDDq$F)bfd|(~?#΢F ѭ|g+=9 f?>Xj_ |5I@/9dD%7ePZѓcn {F2yM3Y{Mg%޼Jfږ[prrvvZ2?\C^ooIXFm3́<3ֶ758LVX !`ŕv08y\gWm.]RWoKpNM˞kJ2 ƥ*s6Uh]9Y7ʫ蚽aMQQx;Sϣk~txvplddId' o~2{~#Vgx!ݚD4U1H@p=}柩i^ LSxZ\F"r-got֕r p4 tJ2 0bB\8|LꟵq9!)?%[sQn,$%*bhºJgN.ZU!(Nt%ަrrbDF 3hkZĄr:B)I rHSf6,#:,O)uqER(9vX`I<ޓ޵h@u&1m}FGVuXD-G(k[@`tWDaۣi=H/œh1D (EեvZY2}ݚqyceiITeu A^JݓVM);|Yam12Vm}Ք030ric 12}='⎕xF:ΐPFF1*p/AiZ7Qeeg}Sj.,.ۋ\sY#I,MEBLrWR0p >O(w} kcmwۻߧKĿ|Lt[Q|Aciؼ-"ԯr$O<~bBscE|fi1Fw8~ڏ9S6nXG?tF‘\亘oi崲[c_8~{;`ezcӬ/2B;NO +9K-`ۘ`m8 IۀFTuE_k_צ?/]=<{<-5u p (z][ Ѝ8>Z]clhch((Ph&=p%Cg' b…@Weo899$+X}u=' JjGZMQEbN US~R~Y%#,I91NOl76frx1w {v}k%wp[gCMb6|k[>=:v߷Cn9~1x#?8<;}ߛeH/̭}X`PF073%y x+s&8?KI][wR|F1 *<*T0ՃD9 :< `+08ڤʻ~]q] }CWlsrCk.bab,T; gtiB{$i'IWbtf;Q, Bv.??ii麶k~?;WGvj?FT];K:b,ilbJ*JU^]O^U6G\I# $!,T+@ejs$lucJ>e3 a_hw. 3c㌰vIK Ĝ(<ܤ̯)F;3K]tW],K7uk6t[[kizhkx ۬u,-mU.6e?xTҴI^n8cigIrUavTHm4+kڑ-5܅ Yv$-26u f\eUhC4eCISdmNX$<#Y<` ?a8/os+F1VWnRJVcwh%vݏqէNt/IT׻}QN~j.G_ڎRxcb #k_/TͶko*NM1(1,&+>< H$|Bխ^A|,- |=x~jFGQ&ґYfR0]V]ݔ.v))[GnIqc3wFF;J *N-e8儯>+J~>x=y|IV'Vzsݏ|G:ɨiC  F{VϋzΡk ż^6YUM(ѵ|Zf6wӾ_.A)|>eZVL/M)<=:Oux~l./Ρ? MҴ%w3٭tJy=&r|V[W{B4U7SUf&іc!xb8˕sJZKpsZi+Z<бqTP߶ ܟk'2 Ծ <cn/.BZ\*mm ^{k߿ީy ~۟n|Y^7n}518a>2XjM5+Z<_ qxC^.eAi4VwHP!{iZ9-@UFKI|Dvmŷ14<㓳t%RT'n /?T/$k`ligWm/Ú]$W7[wYk{n=㧊3r?VxQ/xc][? Lӯ..ny$O팒 /k>AxcBѾ3O krkw]j4B4VH&i"e;eo'+a(TS Bwsi5xhKJu҅|j Ŧ774SO[7hZS~%|[_~~'X.ᏍtMZ -u^Ƌ[m.{{wfCK5vzo!j@k3%"YFےEiy._%gO3iDe?f !X#b6 6qx8Ҝy^6qQѪQ3{%w&aBr( Hʤ]$(Bk?gރ11~֬~ֿ.|8 yOxGGԬu  m c ֍ k_Uox k7OYi Vx_)< xxKƟm|W_gßkii|UX,?=߁f|is̖F{d3x> xhZTE$LDyPq38?*?L n>!?m50Yc~mlկ6P]]3 #p^[ri.i}VCb1UN:ETȥ*ri(ũI>+()I9\Iu%Pq?֏K}f⫩'YnFh@$` rH-xvnvJLxM ](ஒ<(X{Q_çЮ<-/P g-)кogHR$W%h fFG<5iCDcV|~~5nKW3G Q[TjpqniII7 Bo_cmMDߊ;EGZۥolYEs~֍j.~ʺw>(%4qO:dYirM "5ͬw/ҡ@%ޛo,?of̟<mc ׼+V[51H(@e) j߲_>Rf>b%xwPm4<,"5Lk;涿h,έci?Ogk,V|TlF9(FIA)?f'Vv;dNe^)&R#{&䌒?ү''o⿀Og~ ~%iWR6rum>tvcDA5İ ञq|0d|42𸴽6:lB_Hgx'\R09W^N{mƿˀڥCgi]Ce`Ծ~ ׌MdӴ˦d=Gmۼhi$[!Ch}ÿU(I+I5 i't曙4 I-֨&i;4ʗx]GQ?#kk6^4%F7eHč fgrM?f/>-oE;>KS[صzfhUkoucM0~ois6fOΰ# gO1M!5}M :j_ gZMޯkvSBV̺TGuRG״=/žth -Xfo=ռмżr1BJl>1ZkO AoKߌ~rR@Լ8w&WLo D1JRe3((OYSsj%^zYkgQi:Dv?q|ƘK?3 toWk_v:}|IK>-Fմ K..XeIͼ*Go?5?|2߰st-u +_|$ա{͆hCπUb[֓DZMqǣn":mo%7δԟKC֞]?^$s sKv>=CTy4.0Kcҭ*^xԤܪ:Bzn\|iڮmbs,U8S;B)Qu\iB ΥWRR)I;K_!Jx~jwz^.ɨ4FV+^jz,TA '>(v;ON&_m|?mGiMn5D\]Cswn{$m1߲ůxG~$);??ۍV|JbxgzMVWfJtP/(^G| ?kEyss]ܱk$%濿c˅dw[{(%~K\,rʤ9W!Z_$U䣇N48Պqg/ږD |a6ύVIo~g|)}c byo8|}΀.Լ<|P SN; -Z2Dk=41>rmTc? hV'ß?ixnhA j+$Ą4jeB%%gb/7x1f zMs^EmTZꖞ9eO b/f%֟Z`߭ݵkql`KcAuzg_R1mF3jRWRSoCaᆌW~..P\IM;ZMF$~.ƿV_ b5߃ +MPhgCӭI 'Cq$o=3ŴI%,#ܿ_? U=~Wv]bG |Q1ͤm%bb2_>,Peυ"'Hm.`|\jDږ8[KmvvQ]]xGol_|)_toZf}x[+; [+cm:Uk~|0t}]Q֚S(T cNY"_ڄagSrxyUM_ |RR)Ös$潷T`ɟ'x 6km{q[,}HmW8mk4PK;?H7Ec {7?u޵A⛄v ?o -aJ#"7%&9\i_h_l_#.ꚿ>/xY#Z/cq$+;Ew++2dVg/9ixq.&6B7HUXʀ2v01 թKUF!4+I5$qdZRwi2m.uNsQIi$w9;o ~hxS ~>tb%i^E|1뺍sMk'y1\^;O-q'Q76S~{ ΃o7c$6PK,q'bn KoxK_VBI漚Y8`Y$(rJ7?_Rk )~~xoV|'>4vU5_Z]?4{ksj&bxM]F=VyMq9MF8{:JiE^%5NJNqYJ¹jRuiF)9{bUnܕkNUdW-~Ѻu/&hu| 6ߢnv6!G`߷5##/ٟ 7? ϡxrTtoM= 9r-‡a6?_'Y:Dd/^?]KFkF)| vRipPݓgBh5|_4 ӼgmՌ+ Sio2TœU*M%hIBqV|K%3{7FAZݝFG "ςcd{[i1j2‘2mf_xM]oƕ̞̚u9$_x.Yfd ˉ5"{Zyoz&qc YU y=$8qhwjw:8;v%Jo^p7mڬXqi1C)״vUC|Q~xwYռ%gTGgJ쬊T|HTnׄMM?Wz]t7 Og~זqH3ϔ0Bl9&uAQG.;Pg۞sGu-h߆G/W~(q'e$6UJt-&y8^rÚ;9~0O.gOAi ? >;V2!{Q :n~@")aɍR5ڔwv|Hca, aaտE{k_/ӝo{/nK9[0䌄\H6 w C'5uQrU=>R?(k0|#M> qx  5bm-V?&SiI ^U<7+Ǻ'τ6-|Ke~(Uσ$^tf+y-.ZKh'nmk/ȴ̑<ʅ:$rVX$Bw$~+??_4k' OK+V6o?ͤBo_g^BcuiS~YN입<8Q^ NW>H4!V":]o8s&:7RR|xɷ;*?CwwӉD*:ga$Ʀ>9]/FX}w,r H[ЗƯxk sN'?hW^?>=j ;dqY=o ɯhڮaasxo$WxhZLRepbQ+D@sA1?k e*UxN0rJt5 jT[)x&)EBqz={DtoƠ#bȬ.Wv0;}+?ѩGǩcfjM=j$I%iBO> 8|}ntwÖY) j%sMfkiu'KIʳ}%m4hݟ^>b *Hu,I E\lPc]l#a)'A|1KˍLOʌ.Zqkzfim#˾8% ~%i~ec^K:va+{9.R KmCW6 fxu/:G~U|R;GO7^ӵfLm}mw:Y%2Cj/t-t,? 1P?g);Qq\YlWC=jl Jh.kF++]{sؼMYCz6盲e9AG\9$ui+q57MWUY*5&%);S()E{Kv߆k߶7?P"EM6 :򘂾aH`n*-n$*Zs_l~$>wĺ D<1k%ԒEmm+̰DdfWRZ#ԧ&%8"(דT\,of֍7hK.vrWj?X)^?\zCxO"wwGį(O_`AmyqmJ7t^SK/toN-bG<#]w߳k6M1k:}GЖ>f7Q-+Kk9e߬\ХFYт#*JUH*j|4%7''\NXZ(Ԍcʥ+ЌSQMEl추)HF*?}Ai|Y_kq|Ka_m<ӥݾmqfajSe,6F^گ(`|+ka5x7]4<+uO`Đ4iog&u;4n4x_@59VnY:Wßߵ_+BZ|Y}*E+y n-|ԖV y#@}_i[ ƥe}Ɖ}nU+2,aYo uII U9i&'tmCҊvjQE XwISS'WUVr%9:k~Ex^j,"\|/(q~z5߲J1w'Z~οíqx{¾^>;l-uݯ"ZMތna?<7?,_xZ ߚt4fWlE!RHfͮroj*ԭVTF)'_ZJ7|qa *InIZ)I% ZM%nn]IlN0Z,TWU̦1[@;,M{ǁ?kۗAoxzkKcZSyj2$a$p p0>7Z g&]ij/Khgf {Ri2lӄ`h%O++Qo_Bx7t? hZ~NrЬw"Zڃ+EmCwtEn$qҧnW'k(M(FpmC ZOSYg(-~M+M3gO*WA|?>xW𗎾}{7?b- -nn>$ǯ_$qv.(Q<ndmGOGyl@6med'(]ࡲ?>0xkŸM2}CK<7hDE'Q4=B2g=v/Vixߌ-\ּ5uo<|0]vK{{t3hln3IWa'+քV ȣ(|UE(,EUQcBnTE^4JUsUg(ƒŦicK&dY!E *U#%) c-m>_CsH#mS4L_멪-ᵸh$nld7J9^@j0 Frx_{"fkV\+GRb041gI*Вu5{ENQųܲhpRZN)>I8TV9ZN;Im○.tO }?uKK--oĊánZuh1k Օ:s/gQ*/;)>{3R^m ,W.zi% 6_isPu<|HCnO> |e|E? V>;q&Yxo|_ D1[⒙?Z[Aھ Ѯ%nRoqr̒*.2 ,aY _ֹ?|5exž6޷g k^&s[)nleXLx 7 =:#_[5*IƴZ=V[U%/vNVWs+ |4u>W~K8ČX*q}ymih{?5hweOEs]u$/eHm[uFcHF/_+;^ f5/t`4h1*Sj>O?_LT-|UxNVɧLmrL X]>{g_IBe(ʼۦR\e:ҽ?u{7Iݨ}\kw_:O[ԟP_~,0("m Kl$t{mĦ84ۍ?Qi[}6Ck^=?<>hg񽾪ks3ajB;&iMwiݾ[xbMG߰?CZ>%x]i7=p.5;.U7QGwx?2y d9<kYvYNmgѣZ|U0OFRt%ΒdԪ`01O}R';x~.c:TV_E*߂lp׵U =koFS={ZAgfjqʳ:d[+ib* 3c6 ,1琽+|WxU%5gه5mW>_- w~,~|aŌvV:g}KL+߳Ϗ [|>+;O._V6+։/)9Hm4ō}^u 4+zM&jTgcpԒqBru\>iFVTy9;r*Q9`q1*oVidRII̠_7@* `An%m202?{~|aoK|$񟆵A3Yt럴wݽ/ :֖Ko6hA/= Dα}OK?0h.uOSlߏxOS_ _| u S.5h5_x"[iuXKZƯϯn_+Ix~{cqxU=g^/|}7KI%Zc 를W؈TJViMFqӓ+KH  xJQ=79+zp5wiIimԗ7> ӟԿfOyT/ ˩\xw~ ]&}ӧ7Uēք[G 54<)Yx h/-ob_U,Ii$4;VgNlmzz]~)Կ_&?M㶔^ӭZ>h&R]|Dmt/i)/J^w]|@7g%?O>%f>|&Û]?Km?Q!} ÿEi/m Y/ubM_UQ֚nRN.y'GR.x08=Vu&(%i>gnG+6njO9c Pr7 CmV-2Fq_ď W&o=ᛍCu4vڅYt7 f@Y\ntV7>nKk-_+ x.Hu7{mkPa]iO$*·#C!(+u[_׈h~vA_,ީ35ɨė_eOΝ AKv|Xו?SJMP1v(iPSNT޳攔e+;:$}4F՟n.5 On{w-OJ5W半[j7g;;.%k_|w~.f᷄_=+"𵶛qy_|6!^,ze|ai IT(ʼTNNTFUǚA :9{V:kKFںqi7n?3 Sx;\~gN]5++:i3 Ͷv_z)%fO9Pk/Uƞ$wt|1$`7_RW#i|sʱ1:Zƶ$kPoa!O^#F-y y! $fkm^+E|X*h<~Mb j|}>x+oHQB4eTTw]kUrQJw9)]U9*s+;j{"/qqվ ~˿}JDj%|a zh>.N?"'J>҆߳&N)K>Va&xka-WE&|l4?X#Un6Šp v476L$$Og^Q)b-4QE7NIIKU%e[9'S S!VQVR~#Tw+EQJ_*?6wb^XOόc"M"[#VoW`i|=i+\v7%տhUOE[|do_L|I5{4-*mBڏÙ+mg&Iems6q`_+Ÿ-lc*xG@sRߍ<}>s+k-oե7D'4R#ƒ/&+ _0ԪcaOQRF*we QrcyJmU>Ҍ% V5IӔvrrL2"oO?7|5(zƿ'Ch'jnSMҼqiuH gG,7pj7j^v[_#xvAb}s{2]=\\Xm")Ymz$nbMO_[sV5⏇~$3׺Uq-7A,љ-"ن5K#Kc><~7>&R?^ᮙ>?B~Xvno,te[ V^饻*e nq:S8EVm(q95g/vOB 5JRJ3Qw,mJ:nݵ{ Rִ{6Eo!gӧ&jmx:4w ѶTK/.d6= -N𮵦$T-"FG&FY`T@^5]r:>OϺ_xBs?W\;j}iڼv3j]m<մ6^=+Ј"Gm#D֢E۝ &Y\1PA$Y ㌖پSIGZԮҭUMR4NMCpxx(~Zq\ҿ?%yAYT_W56ɡEqRȤnPrþ!5%*KSM\5Mi^{p;P^mcȱ);yBѿd >;nq4!nIt!f`Jw[WAE?웢___ً0MZO!)!}t*KuieqdBwoլc6ouß\\&䍕Oͼ#Irи?dPQ2<9q_[̱S7+%hb#MjB-Κ> |ATRå&WrQ4vz+JIn`x?dR[^k4c1iVn:MJ@A j q?7B|ifK|(1߹[ ?+kq<%>#iV[wf wj?8WΉ6ut hz<Y?"ZG;χVy4`2}U~vK%M~XSJr֩Msqsc8'>훍Q4gt*p:@㜚M31ۜO7 f|,]/𧊭LJb?,#ro5 'f=r/>YuWS|IUuqxT-,5_j4*/#kX5UHU\#R4?c%8FQ[qmzg̷kݕv_G[/Xʕ]5jvJpB>.rW#x/Z!xkXpr[Wnry819 HeGT˧Aoa_tƊdwCúhI!0D/#;M߄$7~?> 5]ƃs&:7|KicE,\ˣo֖^s<>~/ ⤡PbDx\geupܒVJ|M)4RRIdQz$h t,|!& 47DqmGvP ` g[Ӯn ߆>%xG@ua!Ev `?Λs7z3:QFcM+m?';fj_^vE-3OkMn3iq2Hys :'I9K B8I*N4^kMޖ#m(Z^&Nu$Ւzty#5?ovTTn#0݇,7Hl4+i&Ls\߉hQV62:VDH>%o E߅Ⱥ։㿇ڍhzƺsy"ǗxExTd1ٻ?n?ⷀ+M.xsRź]r2}UũX͇&)Ee0K/Ny{1 p!)?l2(6i*ZQRJ 5knuO1pv〩&o56k4Sv:t hךԡ+>P"*y[2RWD1!]>{6cawQ[\2E>"!IJ&MMd9#|g0r٢fN KnLaۺlh)ghhRD׾;Rxߋ ħPg -Ak!2f΅ev]mm.%7Y).>= 1k֎3/N,^)ujya/gqY!\uo 9/uJ7\?vM@gh67 h(iL C71M;RrXpUq.K#$4i/ZD\c$.R@6V`9["@d h5=NP94g'!m8XIqz-o~g}˹S>זp8l tķVPM:^_&"9La&Spn\屰 3ҷLvo`V`K`Y9KuPyejJf/Efו4Qi[{Uo/-O j!~$~muIAíMr>Gx֙ !x/ki~.|_rA.},>mb"6Q~eHxGе%0"!c`d;2O|kč|wNέ5i:4q^^=cػK;I̍oqnd Z~HP:ԪSUیcZOm9BgΡ:!Vgj+םZ1՛SQsRj˖ /'/[|=i_ZXZZi!Jѷ7Vh-]@h`AŬT+_,~ ?<+qg[l ww#%EsgĒAilu iƁ.=P((k g^:10:DSd$0nh_WUԵwyem#7ũ"?wGIk 8ͩ ]f:T:LJnm7J>..t??jW5GYK? d8^>>3>27]XI,%!&6Ѓ=Z)WnokUi% ۙK0o7e+J7ΎWJ Xk %JNi5&||.r0OïD΍/ok:3+j6D'n{ ~$xLy廒_Y`Bgo̸RH]_Ho*?g'揣D UfK6xw*Ҕ@<\Xƕ T9A&ʩ'I_uydXɭ)JKE)qi6۲k ?Xh !a N$ d%e{1\WQҿgk>;זA߆4ebKV**|*LG kN3~ >,]xH:?񟍯Q?R8KMȿ[Cuu'WWY/rAq|>ָ}xlm -̌ q#¦M~srér:tg4cmKfӍ-RmZF7/ t[Ol\ƥq{x$~u|2o3j('ſu/~=m-9K3uWic,(P͘@t$Q W=:*suh$Տw2E3D ŷ+qfoeƅuxGye$qJQTQNjJ1})Gk$w傞[KԭCM=%gﴦܹiJ1QR1> > ڧIطE34Ҫ4rȨV(0-崛a$3DE x)HV@*Zx[-~zwZ}<)O#jb;Ie06ڔv޻&e 8'R:=ߟ).5{O9x^OžcCZ[ :;C\Kq0eNHrž&칓m'{gy"ī9V¶v˫_7uJ0Lv\iVZƗ<>Gwe^[KvKqW鵭<+>Oz݄~|COjwiZ^>+wMcQGkn%`xH9a(N S4+~_%-'/IX.!m PҕVmvfEY.aUC_؇N:iqoei<|+K+ؒ(Ǐ`4)g{vaKX_X 7[;\imt۳p!:ʜ"-G~HjnO(?C˪i_?#OеnVuxtﴹ-uN+Q{eqm7-B/|Dּ+ړFRG)Ϧ|07>7s_ĖZu;1O|6DEf9w|Cj)> |[F>xž4oBPf$#3I.߲#@Y#˵BUIfGs *ro>WtI]EnWvVWU(4jnQS>xW# J>|p ]!H \0 j#o|h{_?1!*y~ Ԛm&Ė7ʢٖ8\\O?i'L_࿈53Oݽ~?XT[nj-O-KPd3bԴ_>8>(YM hqc2^$kyXmb&$~i5',}"8>ƞXnYVxXIn$*Ua_ ~7C_ &i^d:7|5Z!p"T$ϳI;u5܏CxY; \ߋi*f55,a$ҥtѦ乹jՃ,_[F8L=L੯S6eʢ(W^iћ8G% G^ɧ&&!^}@|"NԄV7- 23i/H hQ |,|{7H|-Etu |b1ho|⫛!P=:kOfXc~Zg3[嶖5#Ɵ'xI휮5DE,줞EI٭x?1q| jz~~*ִ 3~(2O2DNEXZF04s̗SZ~LeJ|D17JJrJ1JZ|n2uI0K?ICQRN?M]Κ%ZVw99.~VC;J<)m /[OGe| M3ĚZǓ@9#%u[dc>7??i6 CkNJamK%v崾LJ.,!~p{9iIh&T:h~xgLԯݕԾu/~4iO.|9AdRfRa97E_8K|:b?woM$Qde7ߴZ&+V@$Ot~ GY>,,?͜ {x$fo*DxL=5Jx2VSM{YVihԮ勄K^+)Y<:OZ^kޒqo q HuO%w|O _6O <= ] _o/ 6E5ܡGeg~J,o |5?*g[o.7o lj,lMKzYt=#N6 ʛ3I8Sy__rK>"i6B#ڝƟvUlhZ7;CGcS <:9o uO H.PMpVFF|Ф .UO*PP匣)IʣmY. 0NQJ.*:{\EetlV'ۻQiE$ܹrOZn6.hT5ax^^"Ԣ&u[m.bN)RܮsM~0z?_{v6_?hړM)|ƛG6i8YXjVѠ[;Q??@:_R|"v-f?|&g!mψGI.\c> P-'7%jmqh~?<5=J@?i/~_>\^n]sY xгҤ񖓥xAyͭE{__\C,8˰•?TcKXMm҄! Tmn?8O & :3^`Ε:Jvc |32ڿj]._ -||?4_,hx{SԌ~ M _qkC/K[?$'/Ɵ&HGgau_,b T8_|5;7ɣ|=qW4J:Md#"5L*aieM)ʌp4B'QFSjkFw)WTO8VjR}JZRrJME$g(vq_1wj??|Ic|i'渵?nf2~U(oUi .>w'?x_$k̯dtKϱd)PMJ>%z~xK[DYxF֧PVʒchLG7ȹ`~*Bt& M&2n7:<_)Cpv:iC!TzT q6+T(+|<ъI+KF6xYF<R,ENRNSX3dit_"OhD'oxRITe}v&⮒\ kBy|f_ ~wߨh@S!s5Jb,-wY̊_ȚVY^ v|GiQ}ZXEβVxSkGppT#a6ѿoQS~u#xxa?o}aχ֙-&jZցEo4ҭ,J ԓIǑU2抍bԒVRԌ"O%RHWFEIE񧀼ScWA{ƚrZֶ[qj 9o[P ~7bgTGS B-MiMR)KINPiJJp=tJ|j$qLaaiLʩNqFxKV ?~#x@< '7w}oD~:5|Ivlr]Rd{&m4^tx<]jzmN(J\()sMԜb0Z8ӥhwQRs5E]袮b]'gw/@Oռ1'ŻM s.ck{\tVe<OAqO}9/Sχ> hZUWï>? j(ťbgTh.--ak}Bm.[&ϋ[yKL~/c_Rk_$ic ]ysG%m#)Wi$k]1˱h]Zm1[yLlRO(n}{ ?ƁM.żἋXn`$:ԳLብ:|ʪΥzrzeF6s:ptT5)ۚqQ[\k.d ?i/簲?h|Dӭ-QGFȱ̏6# f຿ o/g.9l4A/lxXOC5_WC?GLվ뗐t⿃좹~[ZI 6zxk+vAf~?ot օ|2Is)R (TK+OT1x|^s (fJ sV!/rӒ6rO2PTj8\VKTPm[bM]]3L~=r6O.{ΟeF^9m1XwnwWѿ'ߎ<]?hO |Z;,i%˝OD>al'݅Rs_ cMu 2.% UAt#X܅ pGW~||d#8?g}wᇋ6 ?#d'Z{$R;WR86b3xJN?QwSpSJ'-.ܗ\U:NqJJ3V1'̯O_-Oػ࿁_>z[kocNOtmRƟc[- սytص7Uv[AxUq:f]DfN.S"1c4F8Jۓ4x|m~,d >Q~1xIԾzV]j5Ѽ{NZ 6$' ς_>=lmto/y/xMoh m&|قK2M2G# *4ʄÛNeyJ'TjѧɅ&$$zFK?ih'>UզMJ%vpTP ;vI%YK$>+oxFtmk[7Q_#aR{o&V +|g|]-5ĉ4'RU|??0i7ClZ\/qyl^;\]^Z<>ޟ5O7O1 *nYduq3u–+!(qQ+QQIҊrpQeE8vM_x.ө*9:URytNi,vr]iN𶉥M}|vVnO4LZimn4LM!`+W$|AO_ 9ZotF?ۢGӾiZ\Zؘ., NdSq?bdž56 MP5爴o/l䶸]7R.fo,j- +\F=?|4 >xCCMSE5蘆62ΐrM̟iKaUUPXj1'PQ$^ 0vTNS4VJkYTqsRMJt][\$_'#Ƴ4?O[Oş|U3𾙧˨ySa鍩Oyjvim)6_Ǿ!7'>&Ggz4j s *obnm'X{gOJ'u%#-RM1Č %oK{WYJ̻t???B/&o|$מk"j1NshsK)1Hldž\( &c(NXTNNп^Mܤ!&eU._d-ӲM}i&M>[՟Qx.xjŸfu-:լ*x+xMB>7xrsI?eCñDD4hܢ.5Sgy xK"4%eܰ";GxO-ivE~4B(&}v(WW(KVgc3Z.i?HOۏ"?i.<}x4;oOfdw-ֳs}u='Rhei;Ewq>2v yr]hGv IfKH3RQ;)x&U^nE~ 1H-=MZ䵻Yc[)71sJ9m5_~9RIJ\Ӓqs8$:SF"M)bVKDyIA׍Pky~$xu O_!VI%IwmHZK4 $?W~gSY>kc7IJ4Iż(HL& |;φ_>ǟ{^2U{g׊;7:3l*1ӍA%#s|>K^{o.IG_ZxRtļ @[-R[\,ORZZԧ6Fq'Q;5*sq撳TW[.Ƀsx?^NVVUgj M|SҾ+xZJ4+/hw2Z2"C+FY$IVs=ܙ@? ~"C6-s6ꚇmcT{]uoK;XI%dmj~]Gyx.Yc?"i߂|9"(oڷv~ȈdžmZ鲆 <߽ ׭gn. [s5߂~x>M'3[4%񏉡2$nC<0f&Ǚ=X`QuJ"nR˖ɷ7=I]c -~e)7wjT%_#t ־/|N/ |=?=GºѓQQl>7tk+F_O|M?'W_ 9o|;_5XxNĖz߂ OZE ,vPFr4 Kx|bڇwPKi7h6V0IqHӵym>;kpC.q*z ¾t"nhץ*R\ܫ': ~i'PGeJUhQRQڟwq^J)1Rw?wjW׏~ ֞5Wd }v2[[#.^$q4mZS~!o fWY9.,$$&IiRYchgrb.bQfjy P͓GTp(BoW?ҡ[HRRupAeyWZ5NSn1i ;[RNJd補` Sڻ-%DP]U2sPpx)6*FW9lg`yd4F˃NݜzW옘E?oNC֎{?թ|vREiP0R]p! MǟS:a[ TѾKbNLfO9 hU2-T[+%T( S (!n0G:oK]EXq+:9HxL#I"T 2N<䙮Tb0OUAΔjRN2WJN̽zRyZJ~v(Y{ѿ/nj5{OjS%θZ4 J.dIb"c y!r~\o٧ eNMo|goxS[e=.jzͭ, )#5VMس70|fC__n\xbV*d֏6i,-ɡX?Gߍ?O~՟udŽF$oxH-6~5Km7v/kk;EŬ44xo119a*ᰔ1TZR2V(SKesn!N8l)88˙Κq%jIV|I?s Z +,|W~,g sKhV''}44vzkMixMtiRGsٟ>5ok~>* ,tmo."!Ck-3(Y_TO|`H|1Z>6;#_G#3GYZؙQTB`U9u+H5jx[]y!4^TFE21~8$# Tr,LN Ε8P79¿-6b%STU_3K5ץ̪EO|\IteN=.?qwu2Z~wtIGrVSu<1j&dVfܚ,ywl6?fovqj|.ζw1eH "j2Zqdl6rAϫ&o=5Wˠ-#$1_>_v9GiGbn|J"ci88)R,,wiYYkg('~Zem !<9~ym[,#Y${* G4fFu@cw;X0. ˸NށH['N7f1( 1p6X; ",]/ыRi6\:{͵giaQsVzkYw/^_kwzդ[C~~"h I"$ ^'HĤ#O.#όs9Z $eBm ╵m"у&<1x 4ii6Q䥭Եӭji.gVۤpjJ/vI]4?p}Ʋj}l4/LjtQܴ9qus04XG6i8 Gw Dy_ㅽ+·m9fkI 'a[P, jf Dvg4%Iǭ+jWCdf#y#i*6!z?EQ;)&e}z%o7(</{S.)F4I7ˮm_&߮i/kz?18lrbѼ3jz{t*NPQ#N)TwI(]KWe}fޑ./]QԌiU*J7r2әZ;$ݾix_|'|K=jBoßP/u%^ .S }O๻yn|DY&?iw>3LQ?Ժލ*X%V5uM;សZsc.j0OςDEC' 9 ~8~՞'ҥмsHJPX[GqZ|,Ċȷ!ףKhK-JOOao|T!7D׵ x?S>!xSq~hs O(g'o;+GNMƝ(E:j&XzuԓWvpa04}){zd{k7,jk̓OٛEc?|1xonou-3!׵AoZė:ַ}":jSąϙid>^Jc؆x;|^|C{UӾx.|_G;BSY>ѥ u,Rkiw%θ+)(/G^7f闾ҴOxlakI%>OPRð[LэΧcMC'~|Oeu-\_ԟ1s;a5/e&t;D}ڌsV)ΜT)c:FM8*%)).^UR|9#sէ*  WK^ x&/RGmi?5(^hdp {v]]7iId(~V>,~̷橓V9"̮ ?> O|=tjР.5KZϦ 0}}4vu$Wgͬ{ܟgS_WFjj)/4~ xnxfK#p|ct{;k{k=6G:u.?;K+5^J5ȹj%i[qN1_\I{j%,UTvԛgd_L_|G~_ )ּwK^8lVI5rsY~0?׍5EHzQB۟5ٙ劜3OA>xkJ񝗆ugHF 2=!I̖K2R>&ݤZVǢO ,:FLK""]%lP|K0TqZ-ɶڤi8%bʣv\M6,U>cKkԿkj M@äE$6%d  |*3#TVne?(?OtO/¿ AiV/mߌ*[6M5ht]NRCt򵰉 wt_[OkV>'le忴jO0KdWftRTq'+'$4yi)(7mOGNYG;="˙YnMkO?Gbz>Ao]5͵-7ln%`jK"WAM9) 6º)4Rx,'z(T$ʪʆ#XzıҲ=WDޏΟLkgRֵl7APwy%4edPR,>ukWIEڛ8)BϚRmEFr^-좒GJ8qݔyEYF֍8'z7mI/ܿ+O$(mm*}F/~-ֵ/K(xz+/Ɛc]D摨pf_)U(tjo'h4cVX:&PK)dol׊ +IH&K(~_\-ᥧ KH%-F,M= eZ0}3 ?h╿?/ۏ_]^|g '0ͤ__ UrtodNL3E׉0?lD<,GG Ok'ʕ+.*<NrR+ŧ&/ Zrt=od);-Rqn^>OZl~ku?.zNXu.uIn%<"<:z5yxhs> ~? }Ko%拮CwXj4e{m$O$VZo $7:,_6ѥ_xqaYel-ЙO"? d?oq+ڇ?Oujn-!^t0SZ9Nץ(NJT;sn߲svqpZ2䔠Q/ӗ/2*KuǛಟmj  +<޹o*[M:o ?z;i:ooI5x^",?5<%KEPJhxAtFస KͪO _1~hߴ/_ 5mB]/c hxHkj^Z wUu=6Z Z4W x{N|mHe|E$,)#bL/H[tQ D #yh X ߓSWzVy4[j64z+OV,Ȏ~o݇WDXS,++ a.bΟ"@\G&㆓o"L+(KM'M%[=,i”f9K /GYsF9ʔdIŹE'<S^ _h&Gm]ܺ:tBL2X8-޾y~sdUUWWWRc6IVEr?08j22fQ&CUr԰lݝ]ǭ\,k[; $6dP$( pF2q:|񌓳-յ-mObJUܕ&)hJ)'!Uҷ*KSo^eϋ߱ği> kږZCzɎM)ou i3dMWzY1YoN~s}*_N&xڼ[l|$Ь쀹?h1di=,Bё?DE>%P7"Ijگcٳo^c>6MVM&ym{z-u&8⻹T19Rtd(Q璋Si'7x4Rqar*q)8Mm5ko=[ؿ <{x1 S'ZV3>]]6#uQ) q?I.(:Zf6~&M#M/i_Zx)"x =x@ənP_&g߂f.g쇦x#RDx2Ğ)P17S'5 ?b3j>(H{/k[Ab7?owIٿ ?kڛ^?Ŀ ֝5΋e?? /.bWDv|=[OBlCWM&k(!刭*sVm4֔W/,af6ݤft)Z4]RSn*VP\jvFI6 }.fǮ#=AH}6۝gnEw, /kᯂQOƿ𕷄t=WŚexm {$w,4KW\12X~_5O ύ ~0hzUW&#]Wu mAl|WVg K),mbqjIIJ Kj-}i(JI+G9F4:]9Ԟ|,O>&^9a{麝Ɵc^ z],:s=G͖fKzgZ?>|6_~̿<x~[$r,K{bKZԏ#)!|/R>$x_w~_k.ro$-i`ד^A~ֿP?x /j z̰x9B- ƆKj;_'Z3GeG(7E8P\9NIc)er(Tc=oygˤM;#_>:xo EiySm74xo^$͑_rX"ۭeX/ o>9cU57<,HM>ˁ-HeOi|\pIkZ]|@We=9,3*ә|1QI (ri+O?Ԛ{OO,5]KO#cyZ"ucy>jSLrF:keeDӴ}3'4tuo:͞6yD& Ype'9LHb9L/ү;^1q).Ys4-iwmK׽[]]u Y,uUGSu 2={@+%i4RWx^/9d"=Fo; hZn'n,M_ceߌp6|zZdBmId3tgN_O?b߇_yo>3Լ-\xrk!<q_^OGLFZtV:ݞo}#ĿO_GΒ/-m}E5 zF? i"U6C5jrqV֭١2;SR,GRtN%S3FbҔjHJ8Tg;ƭ8BNq)ݧʥ$ h_k| q!5B}fNI5-,ɥYH| G?j |!&fIWa+~_/b&jcQҮcs43 V⯃~ȿֹLJZ<1,iז7>~Zz}ݛr[\.xsCWWnҚhY&+y@CFvw.TN:B>e^$ۂħSua)2ۙ}9S񘄣>ITPP5*t~)X=iZlC+mJ1V<7-̲I o,$^1t _?>7ڭ~(RàƲ۱B$Fȣ,$F,mƍ mu[7NmI_[5#^# )7b֚%>,t|'w}V}?Pm/7L񅦏1v5 3B/-VH涳+O+q xߚғN*QMYy p15FS mJ0''gDu5ߊw7^,LMyo2 5YA4jc]R1 `Q?K_~:FѼkgNУӮHMh],n&UFEpO^!?nOOuo|T- NxkkmTUqI+ɢ5IcOdOIM co7?6 k4M3w7X]ׁjW 8o&Xa2Yݘl-a8rpZSSXRJPQ)g s9^-.e?1X*zj*ѫQR`얭ݤҲz!>MfH  2$g!+IֿR_WHg7Z k.k;MxRhEG Edi1 @cr !\++M61P=P'ķ^E3nU\j BX:F)NjZ%e 6ݬ컞|Xjvys5kfkٵ(Nq@P-ʂRʸćy4?'oS}* "+l,hCLgMص *A;H\sg/u&YN~3 w;4m- #tGq"۶wGN3ZSiѻm}-𵰸;(֮6[ktoGo|FZ~"K84{[Y5vZ;{Kvx(<9_tZ߰_(|II*|, Ocm,ʧ~.th:2hk/n|(o4|hυm<g,􈮿]_X-7Ob">> V?c?5xoτ|'f*6+3s*[+_ڤ94eXu {M:k<}\>E(ե$Z8'O+sB7rڲ)8^ZI?ȓY!EI$] *$ L73LmO:E#&}vr^#Cg2JJA*L<a XL^חz/t^1%?g⛙%’ ۩%y/kw '!~K)č㿊Cqpc{ed'BwfIITU9+^֭'m)C٫ٮegwyk+G_Xɨ+V'e9%wy;S/ߵo)__5}#ĚW ?~)JյoeF\./ag)9BJ6UܗʭZ\J4ӳQⒷ<&kv2H:u)̈Q<(-A+T nA_J`s9S;#>3m,~_מԵX籹/qrE-FE~#ǺLZb-s.>6’3Efn61<yloȹw|뙕Nּ'?}7ZsPֵ_xvS!@V;n"Xd#8P[S ^lԞ-B5O >-)hXD L-c,-”S8T|Қy}]FIeBJT1XgXՄD%$KM'Ae' j? jk~]\i)"SP<%B:)kiڽfwuMBkoYMkv[;CJ]jY2*v_>Z.v(Gm_D kZ_3T6oޅ6Ỉw@۰@26A QQkMGuniZ\pqZԥZ',< VV]NzBQ-E~) KRvn:2@FJ r 1ξGڀ8d-3tlŨ8~΢0Fӂ䢦q>S{w_c18&%޸4Vt[En3V+Yp3x2ہ#uWZnޓ>EXne H l۫Խ ʁ$r:;cٯAm$qcc)D$E 46DJ#n E&2g$k>Wus?m>&ӗo/xOMnQr^xwi.ZB8p""`\FW(A$+ddzbMk#zٙ#i)a@Nvjp( pC:'k x\(xMZӕ$Wrf+qmTI #ŷ0JNhS9!Wo{EAA~꽥&/ʦ*JN-ܣZTc6i]\ 31ʱ8U!FHPI `- PO=feέrvVU$c!I;I j^^[+ ᑒEyr{5-.zZzJ)E4q\ь:my۱+`6vy gE/v0־w21-˾NpX1#9 ttm{elH0:u5,Kpiq%,q x|BpnvilqoFNJ0NݛR\ܬU+MkNrx3s}Oz60p2I2zdY"1l,4_k|5ܜmBsW–#ЖPsZ:M]ut蹵Zoz t3{8m'̺bŭ5t^d<,tX@Vw|Sǖ%jۄ̶vm !,YYI}`L>x@JI>.6֐2w΅Ҷ߲'mo\ 2~MB*!qBSN1Z*Rrzqh֭<%'V(SH)Sw|rZ:+(7+ߙ*֬ P [8 x'X;$n \| ḯu#?/kwȾ+qk ]hUO`!|GU4{|:v4-HK,K;́ĒȮ<̍(CNV4}4I/w7oVMF<k%RVȤݥQI[0lO'''@T]Ƴգv O+$Vڎa2k5i.xNL_}!MbG^am/~0S?x%3ǧ,Aŏt^v5=Gk @i??e)_|<QZA-WWj??goK;&bECV> 䰌I.k3`- W;D7ƛ˝'Q?7ÛdNl 9R4 d][_ൃOS4O_znO$Rrn1,,yJ1jSԩFR/~/XZyPk[(5 RnY'cF- q̵??W=T\juP#n<,r$^%?vD]woGqQ./|eo= V_C%5ed1uqmRXGIP|Nn'4[!.U5IONI41ch裣ws 0K,+ &xG>B]zL,_<%aJ[iZ.p{3+ƥXUhk rN&Mb?_Xe'¿~ ~džuKi>7~#\iɩi՚yZ֙a<՞\GZ}ik:5wU &r 8C5MΡ}KH+H[^)xe&bŗX?mW_Pik3Y-ΡO\Ywc鰤zM1хX|YPH!iߊ4b⮯|TRbO@ }p &R)`85K Zp>nhUӔRsΥJsR1 h1ja*5R.kN&Me$VbѴ()g%g Z6%w#t7-spb#8Jak h|A=;w>hÞ5|dP"dt2 *_GI~|;? 3̚agjz]Njs=95%)!]R;+ѤNw:6g0I)n,4_IV3%$7,nu'6 WTܴ-T< V:E_x˖j.IjOi4x.?0NSNnNI%}Y+\58 ;;}k}Ƥxz$1Zk4H[Kob$3=C7ؿ>h> jl5j~/uvYJ%\qxY6 zeBQԵ4#I4yoo(U`Y|9Aͼ$YC.o1-U@U z//i.5F ux[L=qޣ}oÚc%CYI,M-\u1?WU e7q(1vwQn*j2֞[ T*>.\ңKϖw'ۺiIE_^ch-Fp_|Vu/S&?iZzj^͟%i]ڮ[_[xV.= 4m-o/$??^j 5xjF}Fxߏm%K8/-Y࿰R24m ۭĒŹ._㏆5?|4Oi٪S?ů jW^,_GGJm&6~[,?b-GHM⏂Rk-(/]VĺYGAguMs],vl(>od?5SRLw1$K#L'+5>/~?T!/u7e~ɶ_|m\xT] 7U\]]|& xz8)O K64 |^_?=Z~-g@at XWv?2mOF/?J]4I?ey\{f*jr9d;唹n&#,*bN)F39ޛ$i7+?{;k0 > g% .A*rInO> 3KQOjҡ9]Ig`>'+Sͭo2hzhRG,ż1PWOk~xVceEE&!2$d1.Bͭa)Xt|JWIgb1.RRqXy(KT,+ѓ;߉>"ܰNž >iK#ᔉD{Hd LN[1 1asG~"[=#AhJHe3Vpͽ]/32U+]%_mJUP0"Hf>g*-,}:fթNz>iTVNT۔b]I*P\'Fӗ/;RPrw4`7O#wqAL"ZKX8{G34̌F,|U> ~,haa;;ž!I;hQ/Ebi $2]d-\8};RW𵦋nM|\syl4AdYxg]V8چG; ]d0 _0e(Lb],ď%"&FZYJt(gkF7nrӊj+ݧfVTӺIMN-ˤnW٧UH?)MA ||o<+Ҭ<^VKO|*b_[Y[Jmlyiς?A<?٨ Z<1Y$۬a[,%bVI㌷:?)=# %fWOks$ӼKh~nۛi% ӘaIJi{ S ǒiQiӡMŹ/~I'[[kiaܡ»=ooʭm-xJU_ _(?>-g['At$xIA2QY^.iks,rE$u^GbO.5w 1f4SMj7u6\A +ϊ$opp }̛Љb l#Ưg 7]FkS6 F9LPimFY !:dmhcьhf*ucU9{7>""39~j7W;ox[+aky5ω>6ԵJS)I8IE'is6ԝzo.ur:h$Nbdw b$R8dG?1K_W:׿dVb;yk):UV^0;3+ue}CԚk7Ý% ./{Ct3i<˼WxS/_ѷ`+`7YygG3$}(uo-Ե MO@l$|/{M.,O]nT?߱)5?|-s7x)5yRAXiڬ7piQfF2x_W߁?_ xS1}>o áik5OjVAp 5<M<̩t#X<L&İ4 [R MS*Z.T/C9| < eKHU V^Ѻ|5y{JN#CG_,%u.oѿaj {UO_/IԞ\=/QcnzOUqW?m5iZ_E6(O|Vii7,,佼[Omn.l53T}<|տH^9Ay jVxׯ&>QX+{eNbLltp_̿WMCQ[xJZZi:k{;yo}O:קn-50VP|DJqOF2rl1j:ߐƭ<|5OU_Wŝ+(jonS ):R0:菎?o|0ɨk> QM+Ԁxm']^&׬]+ÿ^=,&4}"$]En^d%oK mߌ YV[}VA{E*p)d%Ë| zΟnh7(x۪\JDF <5\s6.K6wqF; lrq:W|&&WZ5&ҳd$VQQiacNI,/JQm8[5~w&xr 7a7I~"Lskka ėY3T9HvG[?~jּCSGOi~ЮAK) ]X[ugZZ=ymbGKI+~Mm晕IZRӥJ8+k5ΚՇ m*j£M'i^r|ҽItI{ >(ҼD|nrI|p5=bG&↋,xY'uXgOO^3(OKxGѾ,0W4^(~}7Ekpj Vk kwƽ,o˚Yb*z4JS%&QiTvŸs̭RқVj+iih(K\ѯ iSƗ|gac.߈Ϭk~wi$/C3=Ɲ}@Km R<d4 .o >[_X[i$nn 3 BC¤6"aY/i3|Xֵ{&t? &Fk4Y629bM}q#εocជ~2x <YX k{0Ytӑ  RA u˨qxΔS/*6Pi; >Yw%MYGI'\|>[~> \`QN9뎺Bx9+=<Ե#;D"7wr#j0b@nZn-FA$g8$5᫪)'d{+hukx6kD;^יzۣdvAaq=3^;^"ל~Wh-0&s*/>0h_O]I;(/$q #f)6G,|~~=ƟjGÖ8f-. pAs%-q $qZvjoQf_VGesJQCMe'k[nf۵x{P֟hM5t,.nQ^y{N \EIeC/o46z_`UfѴoBUͪye<_g $.":z"{ KXA-V$RϷY_O i[ӒI 4(2'q pɰ8>Ox׊Jn%)I6zZkNХW{<Y+9k(TqJk݋WC5_C / x{\Uӵ &='ʂі#,n'vs ['Kx/^h23I+ǧB F_*Te$-OH#? H3JOlܱUٚHe KmפCs uu٫Ww"nigVt|V%}ͭ<_Jouvrwٵnaͱ?#uR*+fw'iK|oUúnx[TҵxN6o^c=Ͳ\8W;V81$Rj2[C|;h!|  H y+rpWHe \/3n-+s6K/ZwrѥY>g(^Mէ}Һў ?g->u>5.%M`C]mu`228;mI2t^Mmrд]F%d5f%hd&FjH^Nk4%Nz(]1@*$=uz-zUƛMo`HY|>#$+/1i.jm&ץsz4[j|ET(=n1m24ӈdzi7 9;g/hM '2\k<#nKkq:ɣhYGŮi"fR?s}ֶr 1an_vpCd0~~ |[)Z1|_xPpR*YXgHĨ'̮ NU\웜(ֺWkF%̱b9ha4w(KڪqUSI~?~0x<[=2MM gQij!MmZ6u}F쒴wf H4~bhi ož ŭG...R(bkyACmki Ө(׼Ww}_jݧJ+NuRqp睔MnJjY>hGf˟_+zI$x.P q+Y Aa?~П:K:y_R b {gdE"$)|,_D2~X6OBηk !gr&SJ GbO~?*O5H/V -PgwG R'G-۔7'SUS_i$i05_rAJ6-CV~89>|')W]}Ջ! Wx2;9u&?#uxO??m$<{?PЮu%ޜ{WBO6$uKlav|?kiŵGb3)X  XzǍ5_CEՇ?h۩~(x~duc m;4lcx#B19[U^&(YoI&kFڟ؋aJdkR)vn?R /O?HOmswVOxjYռk[.,fTo?[ͤH<;\!5/o/ϊ$_`-5ؾfo~aȮ![%[S ?୿WƿG>~:$Z%_W6Oŝ:hOl,|1:c~ 1.nCmlg>[֒NWMK;-4:nq|ɭ-m"ڳ?BW!I  u u{P w l=O~wɿR/k=4KX_ h/n5Q`5Q=WWN-I8 fCQԵ;;DKR+E%վ WNҧ>9v>]T(q5D$Zgu/_yp-Xw\\ ]$PG u#b.u<}*EZ:8s^/^l)FJO'-|QI{͵hGEuik[Nx3ُ?\x_Q?P<%'KYω7VҦ,w+[KwR%GŴ7'wND<?ړLCÿ5IxCVxv~17MuKk6z\Wm!lt[_#pjq2b^G?\ox[?ֵp[G\X? /8Uo.MSwR8I i135xgGn\;*C/O< xw-] ?fx,^Kwn.u[ $} P?l_+ߴx#U,VS.~+xJ m>B׺wcZi"m$?e6vY +}7$,[TɆ/&T\+'MQNQQiM*q_9Bª*ŋZksAÕԔdή4[ZwBK]ĂcDX 4'3 S]S:jO2Q2INDl-*# ?tUVϊtkؾPo-6uԼ12>,OFi ¨+:/Dڈ5-BӖZwkXLFP3y&axJ|5?#ѧkۋm>Y5T);F)%rwn3^!]ῈrMj'f*Wa~-_2y`0fb _jʄ2 \[BY2Spha%o2xakvt:LPw?GW\ݿ>/7WM*[xw|-p.Z#lw&k eG[o+ӄo6یj8r9eZH^j.XQI+{]F\ϕ(ž^kۈn< 9Ig` d$3$* ○t/|2bqڶEoMOk<(=ᘡakŭĮH@$~şhO Xg?R'asoֵY^m7P~m>ZW᡽ͽ/3xV/2ϧ;M2(o%ϙXܴބr'I9TW2.&}Uk_FlCKSO$ԵSώwz>7໛xNeq}\ľ "N7)o~|;]5B><~ڂyv Z??V1֒ȰӯITU*MXE;ӗ7 FI(5P ΰ.1QRK>^TN^۽A5 c7,4_,xWVVu|;KuiaխFiO7"uj͝,ߎ2ʳ>~4ߊVPEH_%Ƙ+vBIo0qLS\. F$@#9WG K Fj4h$Bi+M[[/mIVZR6ܪmI;]VI6~= _X 'mљ"^:>O4[zo^86rOw8fH3./۬DHX##80Goy{ω`yt~ rUX .F Ou=+3#G|^|Cm%ܲ?QVI+y9rejsZƥZ 'W\溚ѻs;#2F&oԩVvSizk/5m4kş#Igǯatm\1"*ڡN@ n&OIj>]1?l1-_6<i64=EVU) L՞|@V/7"MfR.w&mi6L2W WgmҼaY|vXMmsuz{}?¶AW.a\uH͛z҆jHbFI{qէ%(rYÑ6mWIumQ{^\R Fjwr~'L<:hv/5}JRɡ|dUsd[^ռAu Uҡ3Bke?7 ҥN8"q9|."Bpg{6:jMsx:8J5nrrqkiɻ^r7??k9Gj__f~Kߋ ]f[HORtVѠۖ (vok_|9k:WW׌kpLs32$e BOve#|)e{~Ԟ׎jP 'W zRihUg^SȑJaY!i!W]S%tR~wB'u/ ê& ׈>xRi N<7L߳\< JKNF S+~ {IjgGU[ ]FL.RI5c]K[-1Mku<ƹxS~ G 7~ !;`7Kca˺bԕ(7 7%=di$VrmmɅi'J)8҄φ-r5&ۊmY3w?o{~͟\{6>ˢ5qS z~xPU⿇$~꺭ݕ֫kv_?hozOX;|:o_6~1wo]>֚׆7ƛ'4kWAz UZYE7L|agmg 3r?+žw;e^bJ1ajګ$%?d>kkP . k7zGotF$,kkO{ DmnKhLExήԽ:QG)rݻ%ZJMtG,h Ė*Hm?ȟ,7KB|e=6Kapm.4I`fT8+u/q$ڛ? `8Kqs| >XK.~ "O-S|;tJ2M,e:T)ҥV7QUJ1QM3'RIFJ.48ϊ3_ =gZ37l%R>3^k<K$v:E֚Jg lge2D#A#F[< _oZ~3W}K?_ovɸ!;?|,:PBW+nC2Y[21jJck[ܳi"g| ׅ>>8Agoj|Rxs\\8EFehe4m(hkHce_M'D]]ڽwO~4.tA_S<r'~$K}O_Mw7BR,i,2-ΛpIm6vڃѕ=8̟ gBNK8iJDe% E|?,NR+^9SNQKƤ]dx)4#n;m_qZ\nLjlFhZݜP 7bYQ$F2A8TvW89u wsm>#?fu> 9nmڰE.m#Yjpi3AshoU>,xB,e$s⎥f%Ѽmhw.ISL[}Z.dI.B/0Ò.%VܭZqmF>K]$Ox%N BڝGÒ E~]{8+j+d(! Y n#Q?acό.ğxi>x{So 2S/xTS? ifſ,,Dh2-?G>`O펯jZo<[yoG]E>a$5ל< W0[4hwzc t{IVj/L\,mo,:UT beD6cȜ˖VIsӕJ!(ΒgbF.׍tnpmѡiFJQݚ\v߷~~FOWW|Uϋ6ޙ"61;qH̲'1~;~7Ih|U]`&+Ӭːϛ{!9[a$ͺvoh|=j,4C_G4̏=&W"Xt%ˆ8^?|{KhOa{sujZ@nv:<(k=Bʅфo˫ak{yӒnUZRPSPu9YGn>CPT /jeYAky_[Mj7R1[0 A=}\-O#?h1uYr^vӻ 7@:q\Ovn˾k^ioK]Z/#k[t-Ti0CH$f oLǞgEß(b&;x"dfeWhٶl"Y1=^_~$kᎀ o<3L*\FRD03mh0>j$u3\zrC}P-mV\Dqz0)BjjME+4ܹK݌N^۴Y9NtݩЛR]IZT+k\_G)k4s4L)YLwZB .GC(5mńź#h2P˰ 2دh|֟7OR|‰#Tv Yw$l|+Ծ"Z&Z `4OG&&rМj3FqS+ʽ4eɲAS[jt'GΜS;{I5瀼M2]7;UK U$bZ6 35Ǘhb= k5*K]>\OLxS~M3VMM  <U'1*d*r0ij4w<n>WwBNvqc1hXW_76wG/œo?ZԷ'} $ᛙ,L15m4s⿌4Դ?_X"n.Wn ]v|Yfw]b9@%$VHv4Hy>ŨayUC!V*E#nO# >M٫?jM=1xE]R|}-ZWVNKU7+~[h>N[oeO!y%F;]i!%kh,ɍ+ m Yxw|6R|]x6?@y0Ļ܃n|&iuC50e*8ޱG"?*Q]"#>'aO(A5o;V'T?L-wͼ.VIqR*!I^[j>Bx7VWI?"^EĿ3KĺX˲q<c,,+a)̩єܥE(Is)JJzZ.Wqm.Tޏޣ^Jʌ' sN3pwI585(i;.kZf=mtq|%׊egHuRH-ZZ/WG7ڿ mr|CoŶ}[ž?J-|-)(O~͟OSӵ|\7$WZvyŚ1t-|)[m*ypP62\8lSckli{JgK7)FVJIտ_˸n1axy抚jӚb-ek韝7>,A|@NoIm][kӭh~HnyuiV~2.i?ī-%$b{A)bȖ+>p?mm APM?O]Z># ' <}IYzWUE[Czu_g o%_ u~0i3SE.iy[Mo=ܐ_t>eMeO,db#{ 8֊SqMiO1ܟUy*sqPV|Jg8$'8G+C>FP^~2wt=O6ڵ*6 AsFfzG.OZ23Y2aUC"#n@ ,M"nI<˿jZI=[@@qdu(8 q8cii9QKQը.^ʹT:5'W0R^We}'g'¿[G)4Դw[ao-Z%sY ?N&b MAxr[д{ FV^ς G4RYt kCPnc+&?)RbUc*J4gRsTe& ,gTOFN

Nj~kA_W҆ї+2ɠxbK^U{3 ̖hh9~3ڗoۦ^ (m[῀o.⻨YYa2>71@]|>k&U9WrѬї/ukY^{kb1)S|sn_uI| ]9Գ^~;eoρ|;㿉 '/ h>QV{[Q7B3uu -cdx9# T~(x+ClxoKko!73Ewkڊ -~4G˽~X^x7VfovZߎ TOgҴKiE7p_2( R֩rJ7}YxB_ߴ>ܳxᮃ5~ >+% ꗓqWڥ4_,kxoyO ׶;TkB5g.nZkA9B:s%?QC=ѕ\,i ij(WnZ`WRQᯏl5iQ^0I@FŲxy|Cho7m8.=0\_j6MeY4S~( 9| >xe[x3/|>*X.όv>tS&o [XuGg<>6uGxo4ղg?. j*c}3ặ|٥K;/.)Ews<qW6*5rب{\ZTUe(Zjբ=bVyK[ ӵ?2+VVCX-ﵑVh*[b̎WP5? i |A.-ŶS[x<,|C6K)|Umeh5+;m5iebGQe IRsFҔsI|7G0STۧ88҄{9Y? j_Z9xK++vŨȭs7(va2q\D9!]]xcyv8~<`hio |A7 GMQIˡv."q'k$rTZ)1RQS$ɨ&׻%/uY-09s=ө^q>XsrAzF2i(q斱IrGػRZx_me𥝍KdPM& wnW;d&+߻?CLoVxC}^>xCIW&g70_B7qx&V?0?l{Nlj];E+xI2;n2dW-},3ȶ}[Zu1߈Ŀ V8IƯI8ݨiߝzR4>4MDQ?$kP] ecǒEh *sBJ*6@Ua<$BQ\Eb;q^}]4;I&}5ge'r;;G# R[А5/ïky_Y}ڶrE.3̯#oB#hl}|D~>[Yw:fu9"KmM ?̫bWW\WOk&M5vv~٦ \ XK=/ xrw4;Q.⁤Eܮшi8*2 'm&_ůxAQ#Ct(Ǩ +:s\@QQ v_ xA=Gۼ6'+tmM\^ \aH8Gtb3K*j3m(tg$mJݿu4ipkUm飴-I" +C"$FWp'g׌VмaKFqt1jtYd{/\M,p36F/͟od+nlnj?ٲ9帳/ɶksKm+‘6+/_˗_q7+K.?RԺJc0?2 KZ/ѝdY4zuJiXVs=/2i)nPO)aޱ|#'Z4VA$V\=ܓ1tLS|`1s mB{)!uo>_xVUvlns 3+YXI`dnJmjͽՒn/x)ԯiZRWe]ZޏwmO~:QU߉JE2^!ԖU'?e-IUTƗEhbx=iO__?hx~R@}wዘKkK-(u+NB?I=~WkM_SK ٤KF>tl,Y52[".@kK E QĿ#_KxPz͢L4'[R^XhmoTz8zRQQmE9kI/I^WI(pl=yO ex).hߙYW,W+M:ðbxQڛu1rtQRiu+hGsۏm&?_K߲oBv^Ԣ9!n56{Es,_YSYb,35οcTz c05EΛ,I~2RrӇ2mIs4`ztqĩ.I%J狃y:͹Iym)Ga4Es)IUZAI|HAD*F)<l͢^hլ0jH#&IԫULsNUU6ܞgQu-.MK] ]I oú^nNyi3!W9`VG9TZmdwktTFmԩ*S)MK<1ZiOEuiGD=?1F0ҵ,xXgem[6SqIF.n1ӝNg'ecxM?J P}Z[_~N[nHw%H/%ZHC&dhO%~!aI/k,Vi^)/':;Cnc5 [4_hb+M|]{nә@L[%Fn028CQͿ.IVrHP2X.pY{ By99ʅ~)ABG\'ݟF2{8J1>Y(,L9W<e +i[[D__~grAiz]΋4з*rݍ`dm FZէdυ?iG_|?g=[R{>]oW&4\|;[3WW> Msyu;ifΟ,:2a";/YU!foY?`$ĿNg7G֟Uݣ7h`,'1^%m&{mbP~]K2刣):e9?ՋJOF߻ɤkѝlf'&⛥J0IMNc.Xf?>(/s;>4>Qu!.vfپ00! cm[P]I+~~?S N>f \h^Kv:x–)dI?#Asn𤖪r)v:i'gk |Ա\)3ڷďKlKu{wyE$+dXϊ^J5-=e[e׎/&ck\\M5[*ΜljqQo6~<.}d}׫J1% J =$ cRSv\{yXO)'2Ef󸹯7_ O|cM/W)YW4cYXE7Ư6_lZ`gß FPqN bWC]#axŤcY^ir"6Vf*T+b8lEWnK hԥk6ܒn-%mZMmZUj)E]fI^\}[^O"ҵדgʱBHh mFy[)G}~$yۙn|77pItشN ᔀɿc]:_ߍ/`Z_7 ]UB  AĘ/Я.uBIgdӛWrI;ۧuREt^_w.JXxӾ9ǶkU_>7>"4 h_SxZ@#EC+'EkbZQ/:_z'|Ao- 9e2,2 67} *Wa~ u:˟^3d2Bd_2apnYF+&zJ`p(QОrP7,Vc{u>#j>#\Mÿ Ⱦ43\1>TsO1+ ؅&gy>QV/41F5+ar##s7ŪX\:a[#]ҹdwFNK/p<<E}p7f3JJzVKӊ,cʮ9Jn-O޻J1Cp9 vJ*rP7ɂs`>&kNg|Gj)dD70Cl,wR|/6׷qߌ~:Mŭ'$3hHU;l B6 I<*wt9ewTjyt?RJz]N-$&- oɥkI,q-0wy<5f+]K`!d[#p$s|qN3ƧNLMvwdvX-Jx@vo;&gptV '_KPwZ5#VNfK9]]95ݽ앴p|t>v7*1XPʬUY8TU{J⦾ fuOHգ PIэ,G9_ ?Qn~tQMjMiſM-z j6XRTnfl&^kEU2Nt9Rf# m,թ/ƃt?4_FBU ~`wiV^ùĂBI# \D~]9q/+(f$ֈh@~'h r52fR[:ٵ-gE)Ȱ K*/kv1 julhi[>{)-%pƐG1|?wu-3H^F%PnXԖG.NOٯSW+&zr#|\a+ɑPax0 0GX*qp|2\w,yyvR3p͉N0i7&Y٧4ݟgj~~"4CkV/wƝ)ίkڬ?HM |K϶~䦩!{7["<|g{XXXO⿏v匿YZY @8af^mʂOo7^i ~D,B*yipeG{e2Y\Z-dvHO^/ )5H6 VHC>EiEJOqEq?)cO%͢0 MJ&QSgRrEԕO|4>X:xlm ,,w(BU8Um' ew,vYwLQ09dY^Ud)5k xHwGGk}^KsD-:=tV];Mm IAF*H $m')QO _!M>mSK~x-එ_m[ƒד?6>hpدjڥJ 4`y' m* ߚ.~^TGa2qZ4h⤭iJU%+]I2y/ g/~_JvG߻#ǫ\^[ݙRn ,%K,o~"vM~e]s .X| /x:,t|CGP;UDd ? յ/jߌ#7Rp&d(=\^"RҲWFRZB})|M5noJWvVTR'տ4]ۨ/Ykx_ cX f?!m{LbC_ {Ki6e~ϿL8Ci#w|~ iZO}oWԥ|s&vb4M+R@Hܯ3*<ˇ۱rDR?7 i|'i㟁{cэB m;R[+;XU#ß㶵O}O"+ ͊(]"]9q4kҢՍIҌ$J1pۛUմ'gD*UӣZuaZU#zQ5^*Zÿ9x/K1]g!$jU␉cTGpdÍGH^.g'HէеH8ZF ܛF SU}| <}#~0Og]״fI3b#l*!W a_Q ?֛$7h1MEdRD x>V^)sUZ'$ESnFNQUe#r\"Wqs}7kb=?Vm6[ᇌ~j67-m)/xKOԬnouU!fqmm#\铭Ǚi,>QNyuzPXYVSZ%+TڏH9lV@64N8F뺒RQ7)EYJզIMt/hj0 3v0lgM蜑]?,cg G IS^o|Z~?SsvYF['K1kJ1pX-&qJ$Ӎ+$އ'x[S4I|/wޣyo{^}&vPM,q][\Wⵈ~k-g_ Ui>.ӣ~ȟ&д?¿ּ= 4wZK{F-AtHci"cR?O.¿ Aண?ۋD?hOkr|4[=>>*RFf㹿:-c4u]BzuZ" woď/_ O&DŽ~$/ ˮI,!f7-ͼZ+~rp/ĭ_!%4~Tn,u&_ڣ+#EmڗX*۬?p#qLT* $Rֽ;rF8rE֩Q(:sN%F<#-J0? rrhU1Mo Mх5PwO?jYiW1kqem^?ݪ>:>%Ͷa j1Q.. l?*OK/_? 0E<2ƗhA6@*&&yJ$8;FxkG-k]mj^4ݼ s%Y'I[u=h$PyqySXDoVFs%u-?[|HMw|=6W\^)ݛ,*m="A 'O:OLx;{V|R!^'8c  Lԇڣ i77V ~>KT{÷xOvXuK9n"HWcСȲXS4bJUr%N'F4KGCeOJ\Xx͸*VQj4vڮ_7gǏǚu5^ >m[ e?,t.}cŦ+^%½~kkvZsxRvvѴiEs6q[GdU%9_O _ ?)WM؃ &+6t$Wq4RƮEΉ wm—^UHs Z;ϕ[mF #8(](ߚ`yэ:YIU*Nǚh%8/4c(׭Mƴi{J)֓VRXުṮWSyvGiI !UQ|?Ġ27Q4#ygi$$Mi</>"x3^t_?z|'_LyZ3wi{kxJ(A#wXi_N>gFVд4_~"W~\Ď7^d(dV;ĩr)?qجES Z*jDQ%eVoGxO-aSSR X QB0%9a}LDsaکN- :}=|M,u%xSEE,IWԆX~EؽVm1Ku_;]3UӴבy`a>YW<!I>Y$@~4oZUկ3^6mj{-#?h wgiU"am4~3^%ɸO},ll&Hڞ#IS#(BWHQ* t 9SPFO>kq?kNK?ko(/'7M#[ReeF~>]SK7J$hԮ[ u_Xlϋ:'H񶮿h?Fs[EҠEד%SGi.-KdƟay_@>/ٴ^cu_$6-P$i4Qo_#5/hh{Jʰ6FhADƤ4*Մ^;FM7wyFKE3_ΞeukZ݋n:9{Mu:|OSźˏ+58v3=O.mnYثDc `̮uJ8,0"M**O kùƕ8ZZGm3j2\YUcU/@ƟFF`YȹDP\ w|]h>KmźiiʴNE%]8~g[k'?4ok[[dcVx.;yxwCI{|J?dY)Ŀ5 x2? Y }'z燡K-VRw{/MZc>%UEZo vz7,-r .#큈O4qTέ.9Aܺ]ݵ*2Qm8.V7$DV(wTlW[F.l 2I^6#X]GO %?& G|MA^hXOB|& lӮ'R?kVGXjVv/jOuy+'oώn~xs|7?i#֯kOg"i[o2+x%΂_4xw?"Gl44a\Ề WcW07Ao,6+V)->]bӺRSkocuKcNq%+YZs-,~GxH{[񧉼ǡxPAXiA4AH O q\o.xP??j7 ށx;+ueoc',s%ͬ HXa$DGMg:n ˒r@UhںjkhQo%e4hp<7d2ܺ_\6^% 6oi_h]Q εyySO5Hqˮi^"L>wkkIF'<5i -KqmpK!i9 h %3/mt%!.(eϜ- I vK %jߵ=?~Fg}+zU&͵;_ ;WmDYkNJ/gV >^Ig/> ɠj&hs)wpvLYdh=[o9`~2ZF~,i{i˪[z<?UJj  t9Gs H@ 2Rw ?RGN1K6>6qp lOMq  ctʃ`eKNRQOV)8h4❮՝b)tUƫ}"ʥ*q,<}}bSW6o35S^gW!֪gYL^(弅f Ci'_gIvcL2fXVX=Âr^>ksþlu_ž3Wͬ\W^#'ƭK(FL VHh4WrG ݆hI&FybP$8bXs (I` Wz,l|B 䁲MN0 gʏZՓFvJ`0L?8&Ƥ2E$%tehO'-Y+*z[ݒVAWO|ISI ikWuȑ˫;(|~궶7غpIMrZhbLm1IkQZn2|KF]x 5Uk=bٴďj7쭧yVZ~_[[<7ƾm3T5h$]D,bdei]$*^ePdsE.̿'6!cIRV|-Y7T{Z[6D|i0xb/i s)8v\vˢwrQ~acy]E+[fdLʭpE:0F 0+BơԴ}QH76HR̡K/'x EE֕4^=ne0d-zdc*K)>[-ى5=Fiqf*YT*7'qWOMM6vmGM]wͻtҵ6/4!WT2RR2]9QJv%ln}3ʴ{vFq+(\v+> FIo5{-@rXJS rd,dŷVVi(r٤+$ݝL裘4UTyVnwirI J1RQRbۍGǎ454xkQv#EG7oɹcV}#G,ҳ"4#Ŋ$JΪ}(2n:wx=^]M&Ȫ$/FP.ahR-NLޒgp6(db\#J$S}gBpk{B;ۙ4ꒊN7:h'ȨC-\y_3OQTmN6u[V6ga ۺDPYcp(_D~Z]O4Kax_S⤱LqZFRfWPcP?'~UoC,J-6P0\4DKb[ Fʬl5O7ۙ>'DQ$8p0͵dxU!14Y]o:$i-58q T%.UhTKRiy97 %iK^W?a&_Ph-牾|Qn Xa4;$2X>nٕaH_Uy_-j4[ki(be.yeBxOW5(C x7cexTQMs畹y}>WչY?1vTy "5GX&>F4\/3szĺ[a𖏦__ʹH+Џ>;DVp .|Af~ؿkGbk-oTk 'h!bַcO1r*Y8Fa[~+ь?&FZ0]LS -~J7GKnYFtMs丛ry@gFf I>;-৚ YV2ƅ9[B֪/iە;q'7i*4ѽiM~&2*Hv0yǏ|6o|1e6C]ҠF{)͵m3l,n#6Q~:Ck3]7Y}|CB!xmyo!h+Wdc~~_K?cL⟈|#ڶ-_(3K ?=,b1<"kQrpW Cyb%tJZ&2iL=gZص;G YFNKM9&dO#?j^O_xKR-N?DD%R)%y&fH්FS*g1~ϿmYO7< n3,&m,.4]Bɲ)Mևbgs:\xǒIe9euY"Š.Ox7"e M{[|Pգ>BOGy 7QfK}+&DvOھ'kh.NeoQC;J,%:.m4$)z8g+3VXL%[FOgQ5x&MYHMwZGVݥsh^?RY3ODq)y[ba"Wfx_TSܺhzv鹟iy㔽1ۣmy~d,/0Ău޸{OeHX+x[AXo?$ x5 {˹-K2wuFpJEޣCe\qp3pNFUjXjMoj©\<QzQXR_En$via<~]7?夂#A je#24eC)]7F"@$w>4D1vf0e'OZ-3Un$Zhh JNAO0/x4vbYXrj_cad.Kʛ&[vF57?x#i&̉#{LaT Tg,ohmu[k>ؓ\c)3,a 9ݪǴJ1CeᦇcrtQOTG* @ , h4xFe;9+c/ +:vYgu5(zi%c՜ hH%J1Vj-&??۫a~*-lB@C^ZA$8yt~2~n,9n4?wZoW\mSa-k2mF& -` cD唤d,ܰ@{ |dyv/;ūh%f-7 ]KFfڞL1 U@zq&"1qapXuK-/ZOԪ®MMG SM)E]y\dJ/Uof1=ߌ֍⽓:cEZZ K07 ~?+Wi/^=Y\xT"aI"JBj6R㷅H OBxsJV-|!W>oR2Gf(C;\0;Cn'`|<6/ |{5|Mh``KZ1I7J2mYL=4lL:Ӊ!y#L01 h@p`e YPZR{:f.cg`,q.PT_C|>x .Դo 6ͻJ}b[[SrX[hWijkj[\>x,Q{5lj>|N^W<}"5+Ķ7hJ]E$7q9Im& +BI~_2YmGR1j2NTk( /u:/OuJK} FRx5gW٨Jqrn+ݪJijV >"y$גmivTf..#Fg%Cˍ[:,7T.ɣ[Rk 6젆nԮVJx f5FaP<,Rp:tG%hCJ7#3 y:Nڕrm[7e~?+熣^|U;LP@@dEARWԝ¼o;ʲ,>c,v?^GY;/[x?xLn?ỻ]&^iR92bTX|i#Nysyi*+[E9@!, _0C6XG׎Y ϋ4Fjn\ҷ[4v23[5!R"b,_,tm'e(j?<_j7p[Ω$kxr_mVi[EX3ni\ٌ Ku koYoNOTkx~K⸶VfmY"9\+k-3O69>tV3<3caUI7Ld x#G Z${ݶkf17~ZPIE^ѷ.ZO= F{k×x>"$|Wv[< $M=̐DXq!BGA~v$~F~|eҴ"}5X%̉/X>u4Wq\,%|]|VEi?.S8tt[$-ܨ L~Hb|8ʿd >$oMwso?|Y3s=ȢN~QBS2^^ c⣢QMvM]4٭l^[NU5yim{'_PuM._06.QNI[ 8K? YuE=v3*p!ۮP8ȑ So+Equ{ow^;ckiY!sJX 6|OIRg}+g).cFk4qQ꺓|Dj,O/!QhN'O0FMs6 EMj5}&yWW؉Td' 1RR9VtݣI>WmJ˙+;o&eU:rn.ri'-.II^<->1xσtG5}GH"|4ԛ--EᛘL iqj^WRn_> j$16Zeʢ`DKXycBx$uWGU6(vI4"DIF2#c_'_u wky<z{3[TU ,YŭտApSq^v䑜2 >{վxƷ(S B9ypz,FUʪ@Q;I\O r1Q1Udu~oum4ݵ, 7ۺ]?>C'Ʃ];x2 ~s) 9(,rmGVaoٗ|e?ϊKඋ6h~|G-$d`$qD~ҏn-~5vII!mrh#j晤5z|IH;x?Oo|dZ3 $GҴGEykk/_}MH)BAҤhϊ,-A 1L/(ېd[Eea_~/E_ qKQq-73<ɋYW2]AsO0m5/ZFO@El\MdƾSq^جBX`G&+o%d>K_Ơ[ހD(K,(Muroҿm>I5zqO)6]YD\ 7d^ 'O<JIҳwnV|hΛ-&^Okk{=. M.~G k{?7z!S0y>4 4WMDH7ged^).P|'`oFy!$Kat0|Jboego[kgfd{: 7)y~͌ȱK/s=" `%:XՑT^G cmج# xUMMKOu*M^M+^џ[e*)ӫ'Vnrqw>fI>>iW# @Y&ҔEc,Fp2mrr7-_ؒ%9xcY&Dth"T;<,k#4.ﱐ::'|wwl"$Vg3uAf $,Ԭkd&K^m9?? 3s,..g9T$Gd1Tpٶgn|VWE*ҫ'vwK,\p 9(Tm mE#7gcv쏋'Q`A$O^¿8.nN*mKwzUG 䢹Gm-ձ?B>`Xg-9 nI6^ҐwȀHIgU-s^Ooiw%U31 gIy|=mMc:nF\Έq%3J!U7g1zOum5nc Vnm/K_czԚ$o)r6Չ."HK;N~?,aR|-%]?!&7|#h-&m M{)J<4,g7g6ҏ+w+5i8S!T&Ӌ\RJN%۩Jڗ oxo⟉.lew1x~G|{Xh-t">E>'H[&xkA.}SV-ڏRM5E- O7H_&3kQ~v \XtPCUj;Wώ:z5?[xMqTk]J +x.jkV& *RM|+STW&a:q8ε?y%Rm)I8S]QGd?~pzzg~t{g2+eo{wVq6Ox;64,hSH ټjco{3@R> mAÔb6#N gMJR{.U{M7Vv}S7ӜcZWI96Eu$wi]}&΋RqrP)^pH'5B_LmCU!-I‚B`1 ɯOٓ"M+Z|UV(OSYs1[Oh<&1M+jG K&}$~⏂'їS;?Ml֭u61d}F3(`e@@Upnb׺/i>Fq+!J3g]Q[?8/>4 oERs㜖9 >V F7u9B2n 7WvN)ײUMQXپZ4$VNj2'Z9O 2_.⣣0 qI$SJJHͨilSԼMi6pO K$ϥVRtČK2~~MڎCҺ}ׇp׿ ~{]C3$mfD$SLHː63HQr5ԜRTEI'FNQV' 9 JNHTGs9կ%RN 25??fW5G\%E'KN'HEji@$R&hiote|F5 | Ać[kT#a3뫟*9qS4eEro|WO#(_Z'|',rS]M_af %kI_0Yß47Z]JJJrn2IofOtr<Wʜ%.X^͹_2J).[IJg  ?g D:wO܃ğG[4md" l_3kn4-[Xb+,1FK!7+vfi ]݊hW60L]"tPʡp6n q\^cioY5M+[[wr&^~յJГ|i?M wύ >f P s}f8"W3ܠ(66L]g I#?ƞV/W'CAS+ $v}[G= 7V/]f<2kpy%vPFT8jo|]^ß4 #_f}Q!#Iw竆IKYe?zoi_ګ\F]Z[nt.4(a[6-`J7/8~G'MMxV? \[?Ю $|ҁ0$߀QP%$~|B~xq{ޟgtr/m-]C򦴺㻷Y-淉/{,z%цnd\yf&D3W-ϖ49qi;ƜU[}R**:VU+BQUP(Wm<ޓa+7bt+{cX}6С5AM~|eV> f=*rA\2Yvr0P78[  %_y.kIuHKs[b;% $w1 dIv$;>*/G\E֧紛45Rյ1#t%wbeD`ڄ%}[Z6՚mEI]>oA&b)9{oK+>\x *6Hv,rO/!Y>F5d&]㍼ꭎ=t)5M .MU⸝೺UƉ"4N&԰'43MYɭ>xGayC$|=K\M61[ 7+/|-s$?ϫG BUrԔZm].IZ-JQRGib1?Y%,>2l2Ѽ{pd7:2ioL&kNuxh7z}Jk- ? ~߿o?cJ [SWG?7Ndx.VDm Q610N2,R$<]<5%[_y5xQ`S_ WI=֓%gy+jmΦZug8*8:1TpԧxNsε)A)JQ|M{M)'qT ,F yB3%V7)G{9Z:? U9i֚ofyyto.q+0Vt*{_ZiEw .u#j2W9# < 0&y.eiE MLsb99kȴ{Mω?yq@e[_h \FC2 Xಮ 12bĩON3qȮԤlUչR/~a0odjF*piM58$+?M 5]e п˴|y?j7S_ GJ,dgcۃAGCWGW_.@13*] @y#kīLIxS&=JE%]7[%*1}miWlJ^!唠O=/)Y^!Y]^.//]DCHW{Lz̞q#1&DXrO-P{/ p|FE֗(px+$%BeVGG>X/T뿳'yo|xwTEShHKcr+pS璟$h)].gV[~f^Sb%˖)U}qQUg.jIFѪut?/9Uh߁tax 7dv-3]B`X`_-Fd1\y;\c~n$N/)6hIQ|6H:ԬAbFȠ0#O&H *A?:~šY5t嘴xʼnm)Ak|68$sRILD!g!)R>\3/ 3_G%7@@@I\rXqxhX%dKmۿq} Ű>hbx˖hL[T R9d~s3Ĥ⟼쒓ݶWևnTI+Yɷegw~_\݃7Q'8c q=NN3^et2\dcz^5Cf31M-8r"#2<.e ʌs |~mq ` 9'!R@ :R^.sZ.gp,N!SpToӡفܕt&$eG+0Xz\H__nȏHx>"`g\#9 "㏌Ν4`TA<ۆIFPUipCt* bMiti{WkOO G޼߻IkmޖǺi<;6% jI5veEEhQy@vy2:?QςG |cxXg2{[I \ 1]B<1ž!ihLB,C22X0?~<3K@$s̎(9<$2(UQ"#c Wbq^+sN&ZJDM%{ni2N&[e[7${6M{?h7[ГZ^ 0M*ZI]qhJ*y.SˊOrȼSGeâxVxHĤ`;a",IL!a4c{MqS·-wJ.]L;#`"A Kd}DkI:k+h/6Ye{+<"CAp$3܌Y,stSPj+Eկ&ڻ^V95xI((4nVS߽'gѶG5oG 7ϗl_mn'O *Ȳˏܺ b}_ ~2o xMO xgIciœC$K,6(%}P7xOb^4"]W@nئ~C3EqMߡ> O>|%[cxz~sk}yfC+}P! ShsW_~~&fl8$1g&CDʊU+DEbBP .oã,>&h>>UAY';|"‘,{Mh3(tY'@,iiC%ʞc7-ݐ⮕K}CPەD#|C׈euv=yz{=x|w ??i|!a9|oΗ} \%16ZAo=Ջ56+1 )y^h(TKI$jZITq|Oq6M<6&txJ*qRe9BS.w55M9{R䊵oRGW;ma*Bl`1Q•2$dkµK.5[F n=n=+ulIqƷ@ `LKsH53I}8)mW]S* QI eZM9r5'ә齛ktzX3+TTtݒ5_N{&q_yϊCD!mfO.#&RDj(kπ-?$Ht??Xh,$9.. C%?aN<'=-lZE&<Ư$$;_RAnq|1W,-̄e88#s^*b$6Z%kNc*.p4kQ~5O'=SqL' "4Β3b#l)i 𖢗_~T7HmmnwZY_ۻb1M.HĂ IPͅ` 9'L|8;m\'G8uwaFO{7S7NjiZmrz6V?UI7v՞Rm=1"nwf"WgToS[y-rw~:*>F,Fh` vS&~ F{U<3⿃>"C|!V[{yYΧq9%R>ÿ ><Z@t {KvдH~`A$BYB0x _Y*wRwmWGdӜZjm& I^I7ftf2Z wzh^,umVE;Խ̂$IؕwbH?pJFGq|(ѧMCVфz_i]xEб _ym;7ÿ |Kxÿkv<3 kzGqgi{oqr72B<˺4 3/4,|7xF5oYnSO fٯᏈVT׈Z&{ _>&l_$q7?|iKTwKI4{{$=C3.#t7OyXmY(RNntߵRi<6&zuެQFYrevwi0ۻb#?VǑRJOx/6b]zuibax_5BdaSafC|M/d]CN4K"$2XޡppIujR[Ť}\<ȑ-Yh?.gf$(+{ >=| f㯇&NѭS|/[xsvf)bҧ]FQ%D&eH]kc1Hai`$ԔiIfc*Tn2s[5VUa/К{ҴRqydQv}K μ?MG|aG|CN"o K5MB1s5ċ+#c$q~gh 'G?y>_?kgw٨zUj0S{%+&-sO9% MC?˿{ OHo :0vW[%KG$rr/D&*][~^u~ 'd-YNx \l1vdϕJYO70ԇjaTE(Eai+˙v1N7eRJ[ʕ?el5 >XƚiϒvJ>/D\WI}`!-mvMOb.$4uܴq,ilcdto+Əto|ZH~i%ݚ%u2Q;㿌^?ůivV|6KgH1@bmI&{{ c"8PjOMvk\M4(҅9e4ZMjQH 0I]=[08l*EU*¶z[cO!@O>-TեXqy/'gaRWp8ǿj묾un4%.Ӓ\&K X)UcEt+$IYkme@ZI]kקޒ{]g~;%3hU3  W# J0YV Ok%Am.%nXGRYd`(9ݷWOڵҵT{Ҏ"N5ε⹡qNr󵯛zj=1kv̦_=(aIUo(h`]Ƿ vcC_-dRj%qEiRA"͸\KJ~54`k|+!O wvMoε}> U}/ihzr㖽 ^M7Bv)`lk;tX$`B'px#V"*LJLK[oM8i5QȞsELN% \촻M-.neJyKW<8MtkNM)^nSwz8TF= o_L񾍦j@|m"2<+ F)&OC_.x.xgdj **&ydki*XoZσu}ݠ ]@@ybtDa+(I򔻔^ z_7>)5>M ZE$VBK{bF6啷M5{7fk}=Uz:[j*;(pku)^-%w?\~'ya6ESxK 5~${ CAg7. [:]ս6opE[X}Im+YϻW[ly!%8FJ'wy5~Ҿ)-YstmS:eΑ|Vn4߈x}$AoHַb[__s+43xV౛V% "MkrKEl LI,2mdψ%|e5k]ݯ<)Zݷ>x. Iچ3ݥ,a$糗I5<[K]4%|-)nD#{!#E]-}6X|_u깕՚^MX9|PIi`WCh K/[sDFpy+sN~WOWl~2s^.oRƟg ۭgűy=q6k0XiVO;[:_5gcV};Yjb) ( -|əi/|#tX@vq7c׆gF}=׈G׺wu.k`KVpVInF mV uBK' ze s3k51“jsKh qeQь9_ EG¯Dn- xE)_c"*5O 1 \3rc)*pN|)֗]͞yAW<+-5앗-~nKoN+gxk}N8aW,֠5 7ndf%-c rGm !=.[4vS}g--+?*!V}+(ūϊh/5K <=˹A1!-#J4pA*CR\ڗe[Im6S6_ tnBRUZp]7h_o_6zxvMV1¾ڟeXݭk;Y5`vʛ},5i(a>5h3;O{{K]p̳;y,[wCN_⛏MG¾=%]oϊMg_s$4xO6io'I/nJM .143Z\VB]>Wx ~o:Y\B-(BK9bij>]UkbeRTT#jt[ѕ.*ˀJ0 ϬZY=,r9Q L=<6zX<2ʴf䵴ծW9v!K9DVI5ܾ|.O^v:fA#*h$%>BfPgULEK_ ZZinZD̍,m)Ce0U?W>.>c7dž>0]a ^ &-Al!GKikX%K&e}Ɵ>kϾ3g<3wC~y 5/+G쐢:wa>&X1uVގFWח2| ĞFmI둍o TІ Wt$7ϧ񟇵I?PXTHn$|آ*`BnF]Lc^N2LlS|reP&pFg$b[9i4 <5&mB*+#d1,GYkKUA{yGFһ[-qf4a~y:~I%dӺu}y,T)Զ2s $dXG$V4kH׵dimO`bB͵sW^J|s~]ܹky*6Qf3>dl`c529@|JXp˴ԆW+BU~ĥj]l{o^Os1QxUk9$WD޿g>c>>("qk-̡IFͶRɆ3_ Z)o0HX>xw<y ߍ yCpׂ3k-q?^ 0sOaz9>2|Lul ޮ)%VVP8N3TwnQMsh|ˬtl{#lZe'):uWJIJ_WmկğV!Υ]KƑh3XL+ŸjĘl)7RVzk;WPOgVg]";3+ٲڧ4/KM[е'e\Pgbi/ ᶳ?w4#Ek}q8p勒IMjRpnMZ<2_|FзE!BB,`6'jxW)|BIwEpclcvC|*w+}C_>j? :h(Px_^D;KxfMV)#e[Y1hB /^O%Þ"5"H>U¬PdN 1,k٧թ'iMݟf:x_kNM^irSMI+\o]}VJ=VM (]ۇJN,Dܾd H13^k'_WI{2;#PGlNTE~h~m~!WS |;u0 iulx\"dR2Rm%/6o/ b/fVnKVRIq#8 eŨa zcs|W|lֱj/d뢤Q@8v 1HE琵 o1X| <ā^QjV;?k+ V^d4^k]ٮ7j99bXz:._yf 8SHx5;V9//|Sk a,TrHBTZt"ʓ՜R^\RjZa8)B1'WsKJIIV]J2M᭖gnOIUa9^5۔%nXG.*N-Z+ތ}y6zOڞ|!ֵ]NDWu/h.I[B7-,>B;|@n MVUҍIκZ7U@[6.Yc\|N Eeφ1Hd}dvB&Qh""oO)/|(,gҴۏ ۗ&ET5)dyXfsq__/كXxZN?6+E Dw :x4;t&S[x{4)ԍ})D|g%Zvu`$:*J0ωRJ&5'ӔyQVm?G]+ ߇k=ߴӧG}_ CXD2߹ݹJb١9 m|c)~ tE?|ft8SO-|ƲGso"&N.D?Z<{|@FžB񮢯$60;;2D? Qr2 cr~bx9¢Wn8ԥMגqk\bUxGyPPRj-ԚѶ^\_gmow o/u{.ſaR/ iUr7CŝWKpnGA/}Þt;|%9KkxHTib&72awAUE7$~uMW)lY;iHby%0;$G={lO?J@d&*$30p"0~ ,.ͧ<RRf7RVիx91|SP[}"j,;Jc,I*žc(Tʹ+C}޳۫ -xZs k\Fw DW3܄$snu.-^ >6E\)kz.RBM;Þm,( pIYQ:~+&4YjxK^I4$7i.d`7'Y+23\ۿfwzj\[B5)];DݵKcgAԴ-=I[p!WVY1A|^3> \OS岇Ko3I #¿~jv-ﵻEOzbVEf2H +dzmoX"K,D$1J$*X 1V7u"1bvމRZUeivBs%RJmE^RV|%&}׉5kU,!4$1&79;p$o0q&p(<_Ho7&eI; m))Y6>ku ^㟈//4ox;ɒ4߶G_͟l ;{O Z&jZgK+I|?wRPݶ3ƪ̰JɐXUH&g@^}[ڽ)'ʒRݵm?7[)5ي1qꔧNqùUKWf~sxPd> 뺷}vhs$BV]3>_;.T~If#+hȱZ|yepVwf !$ G&xCѼQo{$zj֦þ1V. əW0;ȨyhKF˰C\k~e&w-V7&v#:y!5ǽ VH|kI8kN[>ZJvXL~*jSnqJ0Ex\>{˕]$ +!B`Hx ^Ѥ|MskإA' y9Iվ}I2;y{;.7F ,0qק_A]KObkmOGVM~Dh<}#]Bu8QD4mG\d>H$)9~w7zoK}?&(>B{mutc:y$$wxRG6I 2|) e&6oc?ޏY{7BVxC>(o-l8-l从kkjHG6 ,#IŽ/F8B9Jt$qmFN񵈓?J\BsI,/U<UB,(!A|ydU.H (jV2eXLK F״Gi>4>>=qDh[~ڇ O>ID0Kل0$5bBt$.vȨ;C)XxZvvJ7k]6㯇abSJ[.>T[QIɴӷ+i9G-#k1ֿ5eG0-vM혝b,]q*]I(H>&o&y^1$d] U ,`2в3yi!5]CRt -ȟXIeH*vd1N@fϗ6n6oh47OLU40pgBw-'`yQjKV}tݫ4=MEEi.e:r7RK.TH%%k9d v8# p9 j\_RЋY`$H$%+.(PmuOJ8Qpq;`cңAuBLR91ߵ5:Y>}>_X] Gx&G-"Zt_M[W{ {_3yc4X&;ĖM -Ӭ5!4q6xG<^~|,Ox@_<mv/ëGZŹz^/hi L0yЖ8᾵L>#R|\(rʬzlON1F5q⦝Mdh%H?lO_oR]CO>'45M6[Dۡ1 űLpLp-1CguA m3~|h;$o71#mfH5j+h?,Pr+Iw4cjMg~·Z~"}|+Iʰ]| c ;Hz(p\Ds>Ū ME̢ծ>8x*a$uz_Ỳm:?V ۛUltzV&|SZ[UiiJ1o C_OK~U#yW*ɽ 3] Ylg:eb\${ =\%>J]\o:ƟwoSX|ègcp),7|my@S Ҍq񪕤V]˖J7mSwIs]mnrM'qs-*MrcʒI%zͽ\-~?t~8#YlgvGI; zq{F8$`.DssMseW: `darH-s8&Vo?[魺۫v_.}zVIvV:O\:W0(mlT81ľ6x_ :ι >]: H'`ƗYvQ @>xd8( T*Nwr _~պ>,+lCD7"YD6̿=A}a}>iիm~8Œq)M%8}nݹl}KG|@h{cF-_@+%E/Y[+ŭFr2o7:@V{ӏ?7hmK@;v8ek=K%5Z ؄Mo sJ-H?o7|BضX+FiQX>XS c;zZ'k\XP-Ŝ3|Hoz5 F;Ӵfk]F 1?ٮ'my׺ZZ:ggk]leSY 1Xӧ/hSx'TcyRǝTk-IWB;t,nCUDJJ2(K|QzeO{O_K=CQ~ ]qik4] Gf{ZY > x?^9ҵ_|:NoK{ S·(t?-1oH7,7 j)xMMfm<)o 9ې,ob s+2⾽a0&=WS]i}n<6+ƼJܒ<>i{ͫ6$l"񍇋 [@Nm?◃|Sk:i|tm|?Kq'[ P躵IZ8bĘ C f~֚.+'mL|.`<+cn~_m&|V-onImlڍ.nu~׌oދ-OKh7 |{ዣ>*_cV3ޙtToK7[N[(^eL4b|i)A蚳ջO09)ż>2**Xgit,+mE Mړĩ ΅ cUbhʡI??)>|׾9Rԓd6]*${/YNa!DZ8Px|%ǥ',@) "݄ER=[yL~ eX^Sq=iYE)]Y%IY'mtG.a,M\[7pVyo/zmחX}F28#v8zr"t y*FG'>~ EmD XՉ",y=-_xoV_7 +@#G+n[{hϜqӳѶwo]75#'#=8qؑӏiSK'E4f³|t~ qlC@kSʎeȌc퓳|8;j#e8+pI:)#cH`9 ,\#^wΎw^Z<" FSNitO[=^=,?<|OXjk[-[Vc')_᷈cÍOƺzO;IEhp]9aF9~!Vo^&|5ķ~fӭ'BF<#PؤqᶝRBrBVoI򫴟Ue S7WF4QJ)8mI[^~!~ '2$xO wn/%&pXAt_k= .LȨqnRP]7 /v EftjT˥:&7@*YB893%}w7g%HuO_ux?<^ƾt e.Ē,v#G_mpԧ*z+^WŇgzmk83vK]ZoH~$;GNu(C8 DV̌l2Q9#i`ѫbw)xk^)g/'KAGᄍ,zE9yqyooiwk:TwϦ? 8|9k 1ٵ߄~W,v67Vi|QmZq, ?O<o@oXWbŗ^y8RyKK(c \,2)I,=iSNIY%$ӲWmmOO{^h^|1qz]hN.-[Ѥߎo'O hG{}یrۘ2%Y6ܬs͗9 )&}M|;I@?[ω~ ߴ7S [:/iό:.Ф'bm$Hq /nfWYav׹|#*##BGEׇۂ3s. y0 _%'+k[IF&|iE{edq)=vѤ?fzcg[ĺ\Qd5oI&wڸB7a +{u]WL!k(FDQ7;m0K;rA۳qlI.dNF9D(㸅<3O:1v+NJv0],{̱FI՚7#XsY}N6ZqJ]z+{jk ;~UwhPjExO~-`UŗGR^'40rebPfd*Qnm\Ko?K]]ޕ :%D1' j̃no1m>(^~hFjLG$gS,72 E+kߵ]ZY>&Ke")s;úf-HkɮdAɷ¬& h57*QZI.i&Q⏧ጉ 8SsTM4Ԛ&߻v|[–~WgnuBO-mTW-p3%BʡM8Q20[ܞƩk_<җy6GARA>l+2$VL5|71QU!)/gQJ5dr;(fwGA(U)^d([mV)44'Uoxz~">t-)>SŚIm  R̎Aoyź++.7Q~}i\~75c{"*hmtrL_xσZdoG$K:ekup^D-(gGsk'E@|\u{5S}?Y-,] .Z3A=j3|A䨣ԭҽnvx;$ޯnJU۩ Rj2\[&ڒqW綗b~Ww{ύ 495YBR e&_,ew>n{^]sĖEtHѤB K)_vq.x#EKx0Yx7A<_(B~QJ6nta[C*H23 _(ЊmSvw_*}[ҍgmM¬⹹d$mnn\[i Q`ϖ.5­¨"d7Lh=76H5BuƱlL~v1eT Xwp ^Vvmw1)amQvM5qp hs2}M}'O?Ğ"ܾ3Ni4+um4dBVHCبFx@mٵy/Hʫ X/<5̚VƣeqGqykFH|I*ʨgRj4J꓊3M-z.:%VזZ)JV眝AF.o.Rm~~׆4O~"-dMto+1"{;a HB%tz.EȱԞHXMQ,,; ~GQ{Wgc(Yt} nr##ܵ\3$g;[dXn);|i<[s+MC~&֠Y5۩4m-֓|ndXѤDDP ?k V_l>"|cS]𷉮$#\\ tTfH7TCotF{3w4ͼ&婉tqm{My(Si4/I~Z. 2(?44 {%j3ڵ Y팤~>| ~%~.nė]J𿇬ݯMBcmlPl^Iehfy-Ο-cSQbeuxne4ZlFov{vRf?lk.gxUן©*YSHΑthLϹwf1I5ԣ5d'噆&1S # Ej&<ܥJwJ-ӛ8FGax | RZW=kA/ xr$@ӁUY"WDP]l{/Lx~<;Yæ4khvAi 0D,fu4 p2sG};r=xUZw$mKDm[mA0Yt\Ԣɷ:W%-ӕԹwT험]9,P1;rrN9$k>x.O/oR%(nH!mYNA./ sG?oO:~^W*.,4D`~L Q)7-Q]j.^9[HS^Nmij֭?/> <9x zl[tA $0Ht`kg fſ|:e'H`G5Blk]`*SvʫCWZ|>C]]Hy W7FR|Z~5k?3:AI$[ >L!LW ,Oo2IW^}u/,rNRM+ϯ?>;:oF6e>etBF( U˱f.E>ec- NռQ]Oxe$?dS2[[*2\B/~ox+ú}6ՔIejY6ܐO/iF~<@>'eݨ{*Ė1'BY%Ee .F?9iV7+&OyqFUuk;Y]|q'k5? |+: =! n7#2r.]jӴOiZN|#!*LiP3G{y~co>(H"hV@DpB_E>a4USahVgq(2{RO U+iitںŮV֍I]Ez%j1G*0WRtiJyvT5%PR[Yiv_Mn&XYR,6kyyQ2 Iu ]8%O3{;F#nRR9Sio>gOGST ih$9$ eQo{jrSr${HB+׾Oe=^ork'+Ԃtӏ4d7(s9Er'wwVwGX]Rs"B^5< XxOm 21y2 ^v[# 'N4mu jnBM-S1n$ x(A#n܆[WŃ_F5 _ƍZˑI!/&bc`3"J:P5$z=W-Z-+mR0RU)Rz-xӵN"(9 !P ?p}7?+գLIW:rNwo?+k~Ly?#Ǿ-z11WBQԣ#OxOjž 24/I "b$r6p$d*J)8ԠJѷ{9;]YOg%ZHQfrrU(68~mϪ~x;Fk-/[ߠk{7I?4q2,)׏|]?Rbú+A|VwX5˷S]yvko敇tmtw~Io5CPvnxHe3xÉ{m+Lq&x]5p&KX@ -\8Dܱt67v,lkU7xú0 GE1QIJ*N)]?_Goi(7wkxH-k_g]孽vG;"%B&ȿ,YC^,ȭ@_ $ w I吻ȏtc#*R_PGa4g_Y)ʅ?-ٛʄ UpA\/Y|3w?Z΃KK#P2 susmeu#F]璧WJ0qRcy좹y&[Nuj)I9C1QݖGl-Gش<,sSMc!JXk͵Ug|AJ"Mm}jȚM[bʝDL F"q^g>}9.rpB['VnےW,JI7iB%~ڠ F4. Wqڣq6xn=b' q(Iwj> Xc\uYb2C$)V(v۷Vֵ_^ܖ%72Ī["8Ѕg#f袴rkvW]oec&GG }oR=Ժ'g.k'Y> [F_E,{pn#]6F'DWn{e⇅$? r0,>iv J(i&˚xNGDrG"kDYJ [ Aw翍םSs92M,p0fB˶8³xg l}I.*K:Y;k{Y~v-N9EwBS|SFܭfgd˾,޳g߿/Xbs$7񏁵xC^Լ;kmgu>8Me,5ܖj#Z aI<B#iC@*Fs'vY t?0Sy>fu|׻t|>VZ햹C :ըE5kFQM&t}g߿S#ⓨ|'8 kw9&bxlm/.cdK+KmiZdۿ\d/H|)UĿƋ}KOIg>GQDX[H$c/4;RO]ci~ f)O5 7al~bTa ͽޕ%ޙ4wPVO,:#FR'Ho"R#_hz ' M][.+{}N|nUƵReKMLlbBRV3q)/V}#Öq7=_[+d,QKn`$*Wyvm;K=9Ku{Y!$v֊y@?U1kj_.NU-M? i[cK,MrVgAhQIJf(cH0 4^ KM7-]k S7;6?QϰSx<;QZNe$Rod򘼓mE;L:h4yOG+'}F^/mt!S4'A%-o3+4m 3^Z0- g·_Jky.y";M3Ir"#FܕG[M|P;cԴw3x%LJ|K߇k+y<eåLӫ|?SRk@x+\traOډڰidC1D2W:28ewڵVX6Ӝe N)|)4 ~7]%|I&c=Zo?C&Ԡ~zwaPYIeou/?a[O>U%#tR1\I1bDdsߛOWHՋ$y34Ű9ٽDŽ _]hz ]e$Q`̪UJYdW];jk3 trtiuIE(k᯷54kX w*'#rmðUVBW?O xx>Iwӭd1(YG&S,Z#6SWşZM6SաM<ڹ_P,Y 2[3m=]nվ)vkkm6?J̲qo+\;Z-vk^yQ}c/_|[T?V EuzmտKhmo8][ ǍLQI x{Pɦ3CƻtF]]=5L`.|I">λ-+ljx KԞ &ka-@\:xa6k8k~7]">}|gJ񶏙s^ւkF7n:޻r2$^gXR5Hʢ)_q~e> xk*T$ch 2$2 " ' =B^8$ggʹ=eݕK'BL{YA%Y~_ u:S\m[QPI&-9SqXҔңGR|I4o%ǕGHfiV3A;=9X"KM'O|Gz[DC*ewtA"*IIlcQ$΁a:dFg矴m k3s!w*9o4^%Z,gIJ/Wgm r\JRiW[Y~{ƫ>RM; Ri N 7b:T`dT ۂ%JNr@I|Ux`4y-&8Xā@SJvl$w9b8۪_`B9U_$t9s޾[M[7^}N,0RnrcQsZ1(&oʷTSRNh[ݮpcO$0 @="ɺ7 qH8AdFa X <~49#98O^Nq]KMUXu{/Nc+'%$ﴣ_w_v?|a?+?xk~u|5>jxὪ$"o jZڟn"o:*h~ $1Q2=Eg0_|7ѡ$}6K+Kh[<{g[{2[ 4;Ÿr;^ûsvT\2l,H :~~ſQό_DsJ?߳η\Ƭ>ڋ|>Wg VvaԮ`_+ 9x攳,pYJFܪmJj YJ+5$9he-P.XЮr,iU):5&%RSgZ_ٟm|@Rִ4sEesjsͧOvlon.YzH[X¦ "I#")b F9%I_\? ?h3;O #ߵ_}2(Y4_x["'׮4=%·hkJN&j׷?صO23i?W۶4?"/ǿ~++E)jغƑr`ÒiI^2j-jHKP%:8u#J[-%$[a1t"ZF-Iץe^RuyFW u=gSP?k~!4? Y`Lq*ZIc*`2~%ú4O]+w iSoT1nQ?#S=oڣEo_>#=YмWid໸SaԴ]^4J"ⵓSl` -6(5$:t 愵2,[Y"D~bDȲ.,rxU;%ʓkg{Joܞcʭ)FOMIjZYե~ ݍ:9㫯8-  KTD״& QnxK`QZ!*&Hi|w`>P#i"flq@ " c8Ԝ<_5OxQ,`Gqs^~"jNZPUhƥpoGk{r NYڣq} 5JTkZMSᯉLÖ߳gorCm"m BN1MHnA0|wchv?h\|5Nk|G6C-dNHWv7¢nG?N3ү(EPW ܌F<ҸPu_5J--mn䕒-u}lvSJXuSZe%r$\͵oXmǩ韲tuIo3kKhww#dK]:Qeo4wViڷ)~7|EǮMKmzg͊v ȈRPP7N<=lo^Ozg-$iE6ܵvIt;hPBVFSi$nV`j* # ylg'g:gI(>֩?%wv{/]zES4J.vo_CEsDž}Y#ӲGRm`_Jo'Rm-]F0+d.U@ra_!imy(ťiޚЫZ9ROkӻVqz[۲{?TIix@Ą~:xu/"](˘rgnppO!RqaL0&q$}*0|\<},t=Z(lYI,u]2iB`D*.% WxG |6_&jIvZkw 3Kt}/ʝKs:.v|7~mk/RݙJG?ŏ:wߍ2=]xOÒ5mp+ч4c dY!۷⟇|#y Wd 0+ C4Щ/'{MgMyu4GXc#~7%jX:8KZ="撊\[}&IF0:5kJ2JTHۊQM;-6LY5i|G8]K.3]2|ϛͦX 739wb7lw#xzi4WWmY80kd庢* 4-:@cU]26_8n V1Nl9 ͞.rJVjzft:TXJsWR%'FRuxxiw.} $ǖeraR϶ѵ-LssvFmXEyd*&  =Osw64DQn<(#p\p kY{EOGץ~jW_&HGVcUi &mNS^ QÝΧ]$ NIa=L:]jF6Z UR.q Tb޶ ~R!8aq$ <#HBF2TV, AЧr@9wM9Pd;j6嶱#/2Bo~j4pэyK߻'v[?e?~ qŸ<,[<|s,4_+]/-mVx̗RĐݚI ,{˘n_( (iŷOO j)'w1򤲬l~J{7Fi=sZnN oǫ|hd :Ƨx?ѭ"x* 3O:f{(,u3tmuVuEBm6)4m,?Ɵu{R+\6o6t-`[9h V䳼Y(%f+ƷwUӰ:m%ηF`R h-"VPG-y_hBo?<1fh򽞓hM7VM,+tg[dH O]">Oi&|rYM`kJ%Wjp# UsUah)՝JqViIӍsB E74ܛoFj({F))5R2n3QN7N/ӟehe_ #?/ ¾hϡH[g )|(]dm#`\mhAo^IW,umo7 @\fD7 kApwÿkιe}x~4=܉lH%|2D7j?~=Oinx3S~\i~,س}ȖEf\4)3Ed,dyR7QQME^g$WRw^rI )S9ʬ*W%RIrpN-^N*Qſͥ![0(ב+[H]YeL*7}@-bҼ#k%~'QCHx:J[EAt GKl ߗzd~Dφ(_L dl]ܑ4gO~ ִ\h./:\M8 0Yۑ>Y`[cxdӻRzZ/=oi,.67+SQwU#>F/yF29񖙨ml3Vb >4&H4Y1Zި|9SPKye"9I##/xǞ9/~5潫Auc$)x[b!Tq ,^BsnawvlG%Dv)[ƣAoO.)MӲsIZ^ǙWN>&\S58%'dܵzҷ].d()xwF;pZ#-aP\_e| YC%9 ]i͢q[X@1\3GѩmF=>!xo|EZGd}D=^r|L",`bIv>Jc^co:H>$׾N_$Ǭۜ-4@4%|W=OVǠ<žxM0%2e ~9aⴟG ~254iie3TΣAv[4̿g=^ pWJTNgʧ{M)''S :~~'kK{Wu+G,f#UT(hcJ|~~׊5[˝"?:ź:\ qAr~^0xF Y8~ !_ҽ~*x^amsz`Vc/AYE02um}/*|p.56samomR{;)l4I̍ L,LwXr2xӄ}EE'&MMkf۞Y^x0vIISk6'&~7|{J;vn L Kq<<1@Yy>ʹ.%1Ʊu~o5=fg: tJ3%g#)` VČ@5|ïiZ\:cF#,dH{PX;oR/EU>Zȿ+ 30ܬ'flgyRvROi9I=t_+Z+~pRqI5&K%dZ$5-;I]WIu/JcS&ADc 1SТf>+DytAlɵŹ0~|4moWuo|@%I|В%e2h72 Op5Rr2tqElcbqX:kޚ$]&mV4։٥g-Z6A]\$A|#*6&yFǖL12h8=>?[8"Ǧũkp }a m.(bCr[$Kv fK <_'<OAsm;ZlyuK2Μ%IFn4aZmʽo#%D,<=-S@գizB`.K5ƭ"E Th&oNSZ]*a mn.+N` syF0 C!h];*\5X1V݀ v3ljNNI'9$^jmݿsKEEZIWm6vrrzf*OV{뢴wwK˸jKPmJ`(eFObE3˱% %ȌфkBpaTr~SVUO^Sޖ$]?Vqk-KI%m/cwo!>|; oxZυB2trGoǁk|)=Vm9]&s[}G/5aYT2&nV #s]ׇ4}IPF$Ee%[hDyU)e5^֫IŶ=.,k^fiXaWS儠sJђ$SݾTs -% Ѭ$D~&-^dЪ4F$y'_>?YE~$s([]E?mXlHg9$E ֗[]u$Mna$ .3ʀFA5o2mB^RS. ks^LM\U5t)N0I6dyprźU1HRx&ɺp+Mdph߲Z_Z==x'Ք,RBǛorZU2\OE-og~ xou{ŏD[=c.{Foqg"$Fd:>ɫ2:x ]V=O_6'J RoF]lu?j[趄cN𧇮BX 4oW0]3|h=2MDH]ʶ,HIuc+:xTcj Dž|Oݡ?y@,@;2㼨ÓY9.!\ƋkFӳB5$ʒvj[I5f IKtQTz-W g$NgMu! hi)aRzwK!0>3__$ ½+1iz߈!ox@!$yehmVUvK"Un¢ c8oJY11IJӬZY-|iX YO;cY+E7t{뫻g_?j/ڏ)+?N~ɲy&ҁ! $Vۭg!b#Pw( | 1(=]Ye%@HuS^8-}1N7\ORwr9(x}ƟxS[Lj=*#9`6>K(=e.XMJ.ܱR\jVW泥åV5Eirx$՞򵖗?.{r"زt!^ VAJUyvF۳>p ]=!9#ϸ{ |9 |2FclQdn]wSd\*Ɍ|Ku/ԟo#}:m>DY|I韺Pj MWX[(Ѽ_Ϧ;#=j`#xUч̱4d迂M{ni>V8lJU?mQuwS/GC{/PVߴVډrs?Hcо=CYOsjVQ5ԚqOc-j~*p7|KgM= $Դϱxwźw:] [H'Y??~8~;.gCNR΢"EYcyj]#S-=HVд[ Zgl/7>Ԉ_O2yFv<u)Kk+dO}^]WΜ'<ݒs)7'Q-,EZɫyy_.c~s:_+~udҌc+>((Ҁz~}xRr:uǸunRmlmou)[RM3ԅ$`8㎽WJz2Cie~=-qAeاtZ5cT,Y Paz{ xKq.+I,rH$S匫r&1m+?jM.$oF+С/gI}fi^2ۻIٶ^ Kd ʑ;ne !NF;IY} ڀm{LJ|CretI!XeܯT+1V~OWQ z@EP I y;FXn<Fppp91ߒ89+'WԓIoԕݯfv"U暻IjI6KޓRj,E/|^Ư">>0|>gݙ3k}#ˇǖЪsiqow!h"?R _?_탦?4F<3K8?Đn ' 0L_ _IxKo/mG.gN 5v጑I# 5- o=fH-ZliMfnsoG A{)&[jfq)4!"?YKቹBOYNѲӳ~qJ̕8˫NU[Qw&n6imR>*//uWՎiE ¨l 82/|O%:x48 0OđB1?MԾ%*DuJ %tOiy[jw~pkK>ϺZ `E-B/'x߀H<+L,d;[p`pv`2NfqQ* 'EU(ťif(D牡QT_U5i8Q8Z0°}7D՜30Ǚ(.w7*'=.Gڈ98yB73c2N;'56W|!o7& kGpFR#Wo)NڀK0$Lnsܛ5v#2c J1U*U4 >X7{}M|80,NxOג:U!}Hi]r94Z&es"luPXFL־|:q%>!NֱMf_L|Sܬv4$QCi IkZ/h<_vm`X:DNpRyV\,ү;rRr';=RISݧ|EZR59s:vs+)(F2nk7fs=ě]3fYk#񕨎\o$6kH;Em"CxONM MI4^c P ۪|Wx(ϝ\֡~7 $RCQe<+Q7l ,hSxZlsYk!e;ͤ\aa!ᶚ%HQB%Љc$c+6iG:o}%a1)"4SWeR*jQvpj.i%om~)ll>)?mOaNSE&$5Wq[FwxX8!/1j:|5 wCt5|Am+o7tr3͇)(il0&TJ6h@ U+0Wlv?o3f ۋb7W. IHPcT瓲P=NN*j/UVxcsUSXZq}'ghPN.[de]~_?F|_#5i<;ԋEUOưܛ I8(#HhtrO*t?ë66g-B;4K3qAA_k&bKbcPHʋ*ehdR:*#i~ּ[Q!'|YqS5YI!X\[5p*,K,fan:+{km-~G}XXu9ƌ. Q#RrI˗Vk}?ڔ4v2 38!,d}ApW,6͗be',l iz|Eg'/3"c_- xeBh+Xz=r-d O0US`e%&7e ɤթ+e4I[ݶ+8y CPԣNS$J>Npouf}ˤ2 #A02s{ֺ% g#z>?)A|\i$zj y(iT FRreE}x}5ĚLl8;3򲁖I9 AhWi_5QJ25n S'hVQU4g{6%-.xswcdIIP2+ a_aSޝ.n#!V@}m]9BTdoz펣;z|65Mu]NٝH!q"̞EM(}앺ݷ9hac*XDkSmng)6^RRKWdio~.&i*H#%6d*̈@36;bI&~ooڟ4/9>u]7Tm.x]UDx 2C +'H'.H~E?iM5QΡ$@ 8ݜ& fRLWE Òkovp4kmbܻd>`Xdw&`Sqt6,.Rm{MJWwUd6rBMӫ+UBOH?yri) ? ~? e_- WfXFd5][)%eŶsO{~-p9VY- ƤZO]5DQrTr~O1zηuiO닀tdF9!bue yׅTm U|0 v3·?cM;W|AjDpH匄˫e@Yx_6-^&K:fݙ1dW H1_?bG )VQiִ]7rdJZ]-{7<؝WMӴu$iBI(|kV/赍S<#3zkM5 1rB5Vv),)#o7ΐJU16=v*2~l-?M}:i;} 2K6VH%I# O4\ovM=jVm+evUt4Р >8젅: /le#J8٘mvR%B)`TKfVP[NIng{M,=ţZ魚W%O=Sz灼s?i촃/ TygTy%3 <󷋼8ti,1^nHb-*1&P~|XW|~{=OcnY|ufa Ѯf?Ԣ$bhHPLSt=W[u|Ghں]gWx4/%G$8ꮜ+ө%ʫӋ֜KT,ގKx'ļD')\M){%yTrO6rQuM`9ݐB~l%H=G`sk׼3xgR.Qy 1e ̊ǑTc&үc@fW3Ʋ)"XР<,3zz>mZvzls3HFI˖J2vv~>?6pb8cwhe! H㜀sw``M,'mz<=眜[ֽ^~Gn:-N[]jjK' Pw2r;gfv~qV-[C5߽)%vU^훽wek8:vJ.Hu{`zvܜːssUOS[/Dzm~aA8sQHFG9hVkoO_ps.N'q Qq]foQ|~*D Wr#okpq4 )*97VƵtF]Q\4KK6Vqrῇ/'~/ω5pwۥD/dR1AQɟoAŲĚ|rpJvQoD]Wg )Ğ$ZiPb΂إ2MʐNxm^0>;sT *NisY%i4ӳmn1[^~_^#^*JJ1wTrqIӺ?jLl0 V! zD(Uc&Tw%ż+Kad.N{t?} Tܬr?׷ble 5\qmZ,68\-Wg%kYFwjSo~߳$_EXV?m-e$HD1@ː|;jm!7+`:K)os2n“>-kQӮCQ!wFnRHAp+p_Ќ#LcglWg':Q^8{SHqZ)Yjt뵿 x򵟍<mvTR'_);ZS'HlI%/ZM>rI^E!1n`_Z tx:.m*!+2˼ewyM|?![9qssּ>J!ʃNFTm 2W U%pˣMZݵv;OMU8cIKa)JbNiʝ2[ \Azz;39 t皣r$#8s?6mmy|9揮E .*S TWmaQy_[UO%FD&UeU;2-$lQҒJ}#溽ڷ1 N4{;Yn2 z̕E٫٥7"vNpp@#EuI$6NUf>u y{"Vy&anښRD3Fp3ʡ @0@uʎ)VtTzu=AߣZZo{t*Y1rqtFJWKMoU>ggvwm+;5o,jq X䓁_C5>>|\_veMZ б!J.pƾ[τ]xgOҒ*'p W°d>}# oiWzF6ºZĒ,`)d`n#beܐ݋KܥuOQijEq[C Rlg6nSӒ;WoK+ sԾ)zR*_G ӹ%7#|#dAG/?"?kVi^&|CqI-̲4VֶfAĤkwO*ƽZc$ڮ9ظer6 (3?> F^}VPVӮkf[E&Hi@s(pC#.jE#I[]uYJFI¶"qe$Jͥe7 |IJ]']qT{? N |IkN{[˫X̋ &I "|7BƶAdO%6&y‰usu[Oo|wta"<+~%τaeiZ;ʵO\-v5xsVP"3 Bg ZL!,|H>7wvm>[Zh%YWTXai"{F˖k9&#>,o|,~'tDΡ.䱐_@,"uYu {)ؼ&#.Ƽ%zMMJPmI)FRӽէ? Zjq8(L+JUQFG:wm(Nq9Ӕ8ۯuu7KGy_W I^i]i*+ ?!֗x;M%K2ή[laTb#pWO4/|MAg{KYHSY " I85&])o5m]^L$|y|`p •aS|Κi(εGMmme{_dn橈Nd]# qy(ErrJi&HSub̚Jk hIZG$ʘdADJ":pNa|sFB4`(ue,OoSy7⇉.S>i:]6UmGr$*HE/1Q#(6% AΖmԯ34r[Ť׽B)YI:rJֵ3ONfթN5%eSYNiSN)FIjTJ\P|1h_SF3xxr.Pl!P֓..-yˁ*/=utjxR^mՐKreIZ#$%̳Hn.ygj]H{?ecb 00@$M&,(ZWv H%n mCPoh'_v뫽kWVG )ԅ׷bk85%y%?zɩGQno5 FdMQMS|sՊJvvJ+#g Ā,ҍO>?bbHO`0AR{"mw6A<9 zv χ@m;OuN<:[r۬4p-wz OHt$PG#YW݆<_B Zu)\,+|ѿ:&$kѨ\/ӼsGq,wOj/s4w # j5?[a:^//7mj-w\\[+1 %޽Zr_⠠N($jrrG[73L4nXWUFNSIƬI:#N4*MI {bZ<-+^1;lPkwE5k`2ͫM46*Z P%_QO_*RG: ?5^Mriey/&eF1iKk{kxcmWWV}sVLu}CQn?ciP 'fGܒwya!>܀ ؓ8OJn;]zۦʠqmɫk}_L*iU|v]%(oJQ~lgԀfVKe d|AہGQJK0M$H 2r9- `'ߦ;suS))G$ve jƞ|SV捖[tQZ_V1qMAU&ni)+Ǖ-Ii~s~TXj< d\49 b {5˻J 笔errvE9|)+{+3n1'9#%I ri/-u+wfL yfccPr>ZI˒<Ð'>nA#=s+"l$Ka w>0w3wmAnUfht_׷x׶l-vϿힸ).mHnr9?ZȻ@ӌ`apVUH!Yr RjK7%A u'*rq;[ ..<}tv.)Uu'8,N7 |}K |RKg,|[l|e%V4iYa`ʱzэ׊ a`?7|Nz{VJd$A9mR@RQXh{(;)OFiEJZ-l+anuc)OVN׌ԣ(k&֗?!u5/6xzMĺAZ5$3A$%~mÂxe|kxv?_X:tdѴy1Q>i[QHa%yևq_=5YҮuaX-HHK8VC46wrdXx|TΧ.ھ_mvv¯0Q'YRU D&?k:ќrK]NJ.tN?6sH!J}^>S SRQJMJj2j\Etc/ ~&p}u$xY쇅Ăj2Ĝ7EXF  g#q֔kk/J]?Iե5Hmy'U__2XH6fTZ+eUSJͦZ;^]^N]Z5+r/nݣwg{IqVy-ՆXأ+Aגn {)FʮMyp6 Tr+K2-Ƥ*eC#Iji|eIRNV+e8 5 jP|jJ-5fK&'k+_lN#9V(Am8\O<0]Eޖf (P$xsڪܻcDm d 9ٲ7RHPTBp$b8`?t;%%Cw|:L:\cF3-?󶷺pM+$E+ox,kZKۣM>Ft%:2v>PB[ ʀvA8+{UH2}5^ɷuK>INZmҕ>QE]seMzz+cpA1hLԵxt`ꓬ%5PeH+Zgikv]d.u$NMElEmZg?Y] \C9 :qq$W2i⏌zҴ];8^DcbB:Ű=G *Yˍ|g~j7~ 3]_Iڲ1q<$ࠌ8_uŦh_ |44?Y 9#$͵.deC]2*1|\jul85Jͫſv6[Vd%yBB-JNMRbՓNqvk+P}B#S|5;EoynE+@KG4BZ.Lot%Kp9\x$g1TV?,swu,GSӜ #v'J98c9s¢T)KVܤ &켻#r䓓zI}ko߿Ѷ1mhL NN3X0qUfm? ? cZ^YI $hI *y+dKO9a~u^8ҝbI@3P2I=zg'*dqЏw_]pw'}}smH]c<=k@ T*oFa`u=׶Gvvr9A8Wtw妋ϧcĻNѵWZA c$dqq]rt۹_Ht=wKT) v+U z';GByx\DnϠ8VV[6_bpx;ksoN:n+{Z\|g0|.)Fּk sTd'ǦF+˸>qve~=#Y&HN 'KK+:%M1EWgXCSRlx3T(z+]/m=b_N/+tvl麜s+NO51.(X'jui]еjJ*iƕˢYwW}nJSQmݩ=/{[ݴ6H =:gҏ~ ssg\u7FFHw_azGW_JI_h꼉6%zd֙,sӶOf9>hXR60x=ůZO}CJ曩iWX-<$dycxn&[⽒KGxu+]7Rz9luxŽmn1[wJnN)˕.kߖ2ܱoc7$[- wzNԛGuufb!= sB,w| YX/|3K㿋4~ͿmK\--B[xdKE4Va$wwfw pG"_b/߱|~_VyW'^&]z4S^^[si+H$DXQ5fǷ746O]8R4n5 dSQWPnMNܱէ;.!?EO ~+wCsc젆Cdw3Ϩ+KL +̂ľ[W i .ud1+h48./dV>A ˷oG-Z'د#g/f mn R2D().-+("`F 0q95IGo);=\-8(N1ٻwn\9=oV ]}[[|~8t -nַP=⼰D]I$؃ [DQzjڭh A4I+Ľ#Ltׅ daH渞"U| t/ 7}柤SmSG["HU\s_wŔȦHI+0@!G8D):5ZUхGܞ,/uVm;Lm#HXA"H%}C2~l $V. F0sWto킠a:d f$([a[-B;v!1 2m2??eHa΄ qeXy⾷ eL^ҭeb#AˀN2+F){FkS`c Djl QF; i7ql<[5o\U*, FDdHlR)ҕ$j]vZSʥ*jyU!ND⚷R8xiu6}շ>!U%>+5Yܙ3WzJ%S7/U^wj4weެ"@<"F1'7I4_L<,U^Ixu^xl[ܬ 2ʯ_Ğ> | M:٬m> kIuv^0%7w1lne(E?c0)7Td[RM>kMb; Ψ'f8^8ƞ&<-UeV3rre:wQi_ HxMDžgV~$e$8MXjPJ{e, b}닗~|(=L^O|]:oY/q%[LOu9bR8g 1VwK}#⎕~GtU$w156a&Y>/?}r D`&KKIм_3^j>4\E.Ljdk1WTVXR_4:5Cp,Rn>x4uJt9F6]smd\ON/أυSy|[)%Ar*vb im//_ojۿ~,pgTi-r99H涩bOOQg.I)ީ_vr|R6YUnf7&E۵џ?i?/|g⋉u{fF|1ԁdK+K{%g(g Y#XcJSwrnHHFr+$.aq%zg;Gwt$ZӮ̧{E6`iu]rK{s|nryc9" +#$ztw`J\t~J@fq's!*FU;\ pG8uf5)5dhC+nVX/UܖS*P$T6egt8gQ9`FzuӋN.4z5u={џ8|Ax-sx*ߍB+f"\D0|zy-7}}~ƫk5Hn:)Qn4@ll+UB)wk1.[e/GfE c?T1am8rb1 8i~QIJ+6 ,'8$79)$T5/y4sZKfuMCCΜBv$P;w\kׂx( מ νN}n{iHRY[Ad_ZJs5p=ְZ^kЭsׁus+Uie4PzLs@#?}NXj,r< !{^ @Zkx][C>ZA\7(Y*VMr7j/vE5ƥiJԗ]9JM6=%?gj /+M zJNAX*Uc~|QգI|9^Rǹuq,C41zJnc {[OEvo+{(]!>S?+/C>*"?{d1,W%R=FT[zn++/kjNR(ӯFxvڄ_RI蕝5HJ_ &ZE`AVUH(XXBQV+x ǧxڏ C.|B/ghR m܅\7xϋgEx$V3wv/Zb *7>Up+v(E/kKmi]]4Ԣ4֍(PwW5N6J=䬺5ʯN~8L=zAke.p}9 rINHz +2Bu τҤ .w['w(Q|QcuH8j-F[ ;`WVt' <$ߊZYvwW~l7FQƥjQiJ7kTWҵ OKRYcX4*QSp! ܜ̈́jvi_Vۮg}[7l'=˖r6Mvi @| l1R9BI`z #"不uoM$dpL?<@BQ%T< yqYQk[.{;ۦu9_㣝G+i*j7KJ^}Oƞ0ӣf7:TUt`Cd>PFzb&PѼa}E%Cc1HQEuA9E"Vpm5-JieP#CEiVW^9nIc#QE]yu1vskgʚT$w攒i&oWyJ]VQr1MNW|:N+Whaz2`m_q1`cghn3lOnue~ۼ[Uw:%7EG<0w뭡s3G\#=z~bpx fOשi~ܛMt-#236==.K=6tbk=H_=:hFӌ@S1ܟ޻pViF릍|sWA~w Fp:qzuKm1c*Eb@{#z*HkwStյ2yRkgE*C J+ bd˪VmibK w(%l ZueY ѡ:Pc, 2+nu! .c4_C/ Y3Fgfd CW GGijZV+XI JeX^cMÐ>ydS Yɯx IZxk3KDL-"rcnEL FYp*>N\rrm+)UPK3TH(c:zxY֬SßG[icDG"<-ԲIeL̉"ڟiwF=+`/X:9-7s 4Q*a'[qPv5W&ݢkV’ۂiNENj)ݜMZW3?|e6QiDz4][_mhe Ei2.5qB'Z+-5X5cIRY7Ȋ ? ?|yr~c>]-WCͥj vbMr2#7Ya}_|Mb|Y75/YǮZjz(aPK )eA76+/QO0QJNIJ1îk6Mɸ쟺mw~|J^ n[9֒N /qjn./ߵl3 ~+_ω<)/i=.ԡIUk.* $)!h+k|'x@{/½}QOxQ1XDu[ 6Z]ޡkpu\]pK~<|&5O uhCmKD2[ƚ|Kk%ś 7 nWX"Gun/?k=M嶓<'eڔMi.nDPIɅ׃?U ?3n3mԩxg >h;x<\ΌXQJt_曌}ҕwƿ)uL_O~G9:e(M> fh沋Pk5=^$_MúƗ'fƾ ;ny;\涺o+yji5=7RN11\5棼1*@; :g$k25='ZIљ ~|syMFzln(9Zڻ$֖5m|O<x"; ow>Vo6"T30$rweyӾk3PW~Hu#ma6- w$% lQܒ')ġR~^A=)StjZM_f駪mY,.ڲ-kw,!c jVQ$(ę͔Eo/a]}CyrI=#MFE|\$1@cd r=GEMhխ70yWbiWr\һъQ.*(.lӌA4.II]&_Գ̺ŝ__,m[!v3I\)(?6[[:ز g卭]6_GkXD]6FddI$UAdqӏTEPR"_UMV:Ms)-󦚜RIFIoSoᦕqe66֙o㤑}5Kk0z&ZFY1C Vo&./;:uί'ٮ\D6%ʯ}M.(f PH $ H&P)RqPKXmIcThB:фaiF1QK)ū}aUc'c|$/𖓪Y4ģCY*]Y2[b8L8ei?y4G(קo#1>]+1LY6 `>p|?smj8E⿅tbiu.7۔ Yk~Om)έ%{MO@:'z *$oJʮP—f`@ϱXxK)v~G&][y>mVʼەw)SM$bbwav?Fʜ8##Fpۇ<օstJi:`]X@n ۅx\K$?dہD>Xc*<y/B*i4Zh~!],I4KIm4 3ƻI1m$_|l^j͇ߍ,TnP]Aw%rKc9 p3ZwH:{c|[V IW錆KW*IԐdc)' d0'K쿾eY7;H:d=Q6#j [8Sdgu3m 3JqF< C2K`!WIih0ꩧE42ĠpXfB19sYnzΫ*_zk^igI.E@eX#jʧ+2Ej cM'L@CA)vHH҅f)#gTnwzu4Ad0 2 5u{_JXHͶ (nYIH86vլq+yKN OУ]Li(w +,X,Wh3б$vڪ 7ֶL[T2D巢#WfVkhCYZ4k(l3F$ #3C,N^KӬu ;B+ :gy5xzﶞ{-v#಺m.I9UXH5hV7B+0HV>wq z\'/(!nl2#|i'qv:ƑczP{ͥ 2'hU'# a@]oX!- o1 c8Wvk{^]ݵekОUW婃ixHР<_Eίk\ ܻUBC 2V[KMVQD1î^<# '!]Ǘ(ņT^Fqߩ^:c(˦=ZIK ;!rxC:k-ihip9ͧ9f,ݭm):݉x#~n?!%N@ܼǶ{E.v17bNI'#׬"/s#` =F390GlVKs+_[k=]i_]M7·wOwի[ЬM;ErOϒ IRIj?ԯ(ѝT଑ b8,@eO/Ԑ '' @t9swsirJ." "2&5}aݵ>^j6eKmo[һңoMv5Kv˝Y)1#< 8;KU'>pNx6xY_ xx­0r !_21w:3L@nV̜.9<Fp>E{fNK㶚_OEԶ^IkMĵ7$1Sq\N=K ?R5/Lv 灵"+Cc *ln}e`県Esw7ؖRU#*(Yır!O*Bۮm۳8/'tmcdXmm'* BF0p@S*BqqjZvFB0]m$(qzX7eMv7M4Kc ?d~ފg[Y6R4 J!ar2CskK1e>>PaBܸcrxSϰGxn9+Hf 7WcYyͱI+>`׿jUuŬ2:wDu~͚[%ky\ܳ ՟;կ[ov+usf#;j2pxkdlX T#AUG@:Z`sq:C>_&y}om4^Yn&.'- g:tuFvq9z/د@$l$uѺ5*A<`Ò~Tgl|6jZF(|D"DR @gDc4m2COŸ{”I tms~akMoA4|daVGEfmbtGOśv( ѬxBTʶ1-UxY!cXo exʰ8<]Yshȩhr\-⡉3[N%%Q6RjMSI6Rn.hOO߂_ ?PΉV澄YF$G3" ETxH"oYx_ Y)_HxO=ލu6as ̻QX`I+O ~_w/_JӼG?`մb4ie]cm2upV%G6!+knݻRp%G6@ Q#r>ejN2IE.Tꖍ&V*<~U MTt.h6I˕5+^JG.vXo iVmذHpHL1dVF$f |v߆#! Ets R3\/bJɵ;+;N]\ 4wr- ī弊"Lя3cDL럴?%<'~*k1F1kЮܔ61Ʊd6h>K(9pu pd煴ЖIv,k o wcf%*W.'a9s&+Ҽ]r[wXl45i}[l%/]o0\|7k:ȷW8`т-ڥ!Ym?4 x'O:F9"O2 RE4tK() ?6ua('Rܶ` ͔PT|(RB;Z1Ym y-Fq9k$Qdu%ErպVkm>kMe.Vf`2B͵OF1 闖Zv5c7 TCH YߋYm+Đͩlm*lYr'Zczm#ߟ`.L{{W-njwo[fӽz֭.JVsҬ4۩M@vU !3W9&LӜ,r$b0Ic*6I ^䎇>~vu @Y 4>RbH@bB[V"6jJڷWoclYomjRt=h k :X]Lh*cr$Q\'cF 0Q1]鍫Z֎Ă/hwˉEq" 6KPAlQg0]$ & ߠdkmooE[m="ݗw{+eueuyM+w/oGYDlI$K 9$_VĕGH ޿f](3&~EP  ]9R_<17$~ Ah̚SE"23\0=в6o5<%]b0?WQpܛNݶ%kMv5GT^*RM/lZ{r0=~Ӑϰ@@A(|p1Țoq=q^[&]z3沴vwm~wnv$\t>H}yٜ zg>iP;dgV˦T5}lP};ݟ|tǷR$Ī)l]Y.EpI$TQ2$,%YUrr-`C{RZv_;sb3 .Zc)(J)#|\Ek7 cʷأyTf),s}0pq |2Ʒ4Q|7SU-$hc㔅fC.r)_xv>u7c^mLeҌc{n=vgg]EaT.YNQ䂂Jy%(E]U Sj1wv0pqԷ=9 %*`1=zƤikKO 0N9cwjmŻz3]%{Iu}5ѽ}祃*.s_4Tc;{+|+w̾` sߧh0#jN@s9'=O8Ǿ:?Z˕YvnsDz]`??2G؁p{%g|;[ƱDL"uu4Vg} @،'Ǭ7X|fȿ0'w6R܌@ٿc''I|'m"d&Q$KVKd`K)o:|QºiQW[s$QnM^ŭUÌp%n֨W*4QSz(ͧ3IKI3 !t))ӎ @$n&5gi ٢ٺ gɥji-A`c9  `NhŨEX 5HHRpy30\Bw.KY sSv772 ɯ̱X6#NIek飻z>stMWz=$+|usQ r =пEkAC+}Ggh v5M:^3dV\ᛞU '|~$tIOo_חVδz|o>2R4cEB;D'WI m eP[]lt@SGM7si%k *4+,12뱲vJ/kಮЬ@2 G@%|D|A)V AHH5a0VoKwnֻZN!b9}NV6{jm;bFt_f۶NO-}汧zlzdF3W ѣH+Q2񺝥r:fEya0((n@:|Di5wl:0X̀29HgىzQæ4}6k]{s{<6x]+ &\Ҥ|X3ix^d,V@d87s2;/4%jCmwMo#X0&i-mFc[t#HR,mLRijVWvPp31 u^k+&/ik,`hX*:!qn+.($˰8kk%u}W/Kiv~xjL:r "Ȏ r>`8:ӗQIs !FFRXW u @ľ#bN~8FXC]$pI9U4n5-=k W˞`&x{+7m<+X_ʿ/k)xn4,VEH 6l.0Ԡ 27PAd.~f$co͕!^L5CWZȺf%RԚM8qbFsvg6cPoHC=9K5fhںwɭwI8oZ[[{zݛjֻYgW{@< \%AFGL=1p;xp}5lY~$A<`RxslP,S=BkR[M8_`'q 6sFjyc8'i8@IӶf9l#95mի65{[з_8?е61$O׌։^$sFrGU^q${G}c$.H Isїc'7aX@'jL,_E/{Z:$(F*~qAX)ŢW X6:I>N룎nxɍK'בI}6#X$;ˤEm,62laךKmw*7`Fc9xFs֒Գdh>tYY4w$6v!8 1=`.@+}WoeL&[l_©hXnSNnr*y,A*0y<6Cs83#wJW{_Oe/[lgq=3P鶟~!Ӵ؂X2p`=I+N82y+9$ XXBBg$2y> X[ĺcZl1 2:y;2dR&I-uۡӅaKWoc-t(OUPSO#;UskrN?N9jV SpA8^QmhĶI8OoO\}3%ws6 ^w`n軱!&RɍPYT}wroOҴN84;HVʖXC3waEO*C!!J2 jwK/Gj+5a>M-y7w0_A.Ex2{W湬Ap|N&𝷼(j87ZcI9Ԕ3bKI++k_k+YkK4qxsCWv3F 0L<ؙv-+r2K cⰂ6| KIoJX$rw*w;8 |/ߋOe?دN^GO|`\xzDȚys]Kwqi.Moiֲi0CsikPxhCY`4Se\A$ej!BvaNTjR:٪\*RnVqqTK9)pp-lT^;ŵ(TSo`f?xz#⩞Mvo=6d\[E%B y?WJ~)?Dkr1A}ڄړr 7m&>!xjzԾ.}]OCxŮp,Q Ѽa!7, ; wB9Uuo&,#hƤtֶ1C(M$bsqT>^jhans^ڤ!VXE{W")F6GR/k(QIm[~|-x[5! j5?={[͵gx)4i_#|Lu-_%{e1ialdOѿ? qRnFG&fI_k7ifcGN"h2[~?H?g/ؿNUGB6-4H3<{kuw\h[N8в "tf9[~ͧJ2ĵ;QENq8t~>-lFcM:sSk{\RN*˙nVO7½OྣiOO#xB o3mq̖#, q2 o~؟n~~_,+^,x:%ZG,e5vtyeg~SGx~ͼS^gOmX a TVMƳ}x? e/Cw &"xJfhLJ-b XS gxdeS ĦpyuʢouY¥jqI/yIݮY-*q/1ƧU;)rіE/vx7o7|1jw[&luif|\kv}DiMV?kt +['1 _ʆPbIFf`܆+%{+<)ik=uYzd$FtY_ 2|Oe|yuKNt](c&#DU,cd/6$.c"tڳ~I'~yi}_~;?QIZ:KK|o7*xT-{8q"rцwC3+Kk` pp*pA$5efH;]*5o>Թf d&`~z񿅯l]|BMb' t< jpC5F#$մ}nIۭj)ZXv?XqԣVxH0+$kJ6NZĚ>_ j &ѥ!X;H\JRSn;?@@M[$^XI'7Z߅u6'l4 P7ń`2Iȵ}GQڸWk<{OCM|NiEQaP)Ry4oSf\yd-gIW&  ##irZ{P NoFrI.‹828@ xD%e <ܱY,cgmOʹ3irHM-Rk=f^)&)|O9&&1Ta1,nۋg)z~/7U VGfm 7vl*Yvi5٥)p 6@%1jo 6INɣ= XKA,r!s9J!B9l~k(l<ɶ{h۵.u M3zb*Hu;#˺mh#`(!~` L}D?UuW;3)1W"?nF "/F7gȱ1 o9%&QԵvF3p+.B 8xUɭoyZ9)'~]]ʷ%mWnʓ_oD={{xץ~`Sy #FpGkert5#v8c`69[\Ywoq-toyO1 l0:#ٜɜU6v~Zߊ&{KDk"3wݨӵ:]8mŔ&kLHu OVb0b R7ۍ r!O-yI*01$qF(&/I%ŞP x F[R=%w9m$ ARQ&7Ŏ>#GPxˆێҤyWRO_x w{|ՉYHkG)#B$ 7u|h躪k\*:-\֗oIR1R9upn7=u鏳#'7O=@ÃsץHs7$,M3Q5}\P-sr"pN-cA,%icXd't<}:_N6ItWVi4'JrQv|j-=SM5tɸA`~h8z8sAG#ߏZ^}zgR[smè$r?OLuNQ2G 0cӜ̷*ygn- E>-~=I϶+B-km9kQ[ENQZ{ѨWg}UԵO#84:вTM2AȚ\#1cp#av<_$;OQN:{]Nl]9=NIIMq`үR&pc3Id;PcT˹˵[yٶÉc8L]7-[ciZ.-4/tَRD {!M2خFɈbr1`.SZVQoRXT:%ݜ66;~>Դ?ocV=KM櫨wQn|k zFa,afl5t(vP F[s_/Dڣڷ+]Z9猴Iq[GA-XلE+Jy~iU:sQ!*Te'$[]]_WRQ„b˧:rr PRRSғQ߃4h|wF4A.n,RE`ەbp<M* X (3*졚*iVS?n##kgm_XgW`E_eif񨺋r8bQ&A|!~&io>crQk8fsUGUyP=5s2;[ pA'G[ിCৄ̮q& x"ZMFK2dVUUw>୿x_>%X`UԩC$~x$共7;y iO7_jK rڇ5ybKTPT_BSЭ 1mZ^\/%$ךN-Q&Ԕj%W+UzV%)%V0/?(goN't?|qԡ]5qemISo7?*T~_c>6` d πI=jmzcuLjrug\eN6a$r$:Ə[GjM!Di$ؑۻ*O%UK49D~^Jm>ks$%~󲶯utv -tmBWM}B⋫E%+9.ras 䖍0;.&Y[57 4zg/ Cω_&/<5 ȋ6y1.>'xfo?Judhŏ!Ky+Knd1] <']w Q¾(0;мU H 9NA?0#3̀啩/KZ]sVJ6s5(UQZ-hup4uӖߛS^|&[4M,ı"ϝDžQ2"!5MgZ߇M-/Y52uwAP) b1_ g(Zʧv#ռJT/|ci |NӌG ~-Dbv+ Ϊ$1UoW" C\e\;wԯ{7NV:ef%FI.Tۏ#"bԽ[wVQjNG# [^.tz– uo,jר_%AX,fA&gsmk~8/k:omoNs$%S𥽴F) \Z EFư΋n4X7]Z>~&l}<ݿLʤ> Ha.I/h m+-ֈyo%F;,Uؼ7*s1V%\¬=:kn]M6}x /VL:~ΕhIR.y2i.u:|җ+ nYxZX’,+>rAnŞ4dEcQoMWH%EL&ZRԲ$N1X[ġV cj=>'gXqH^-n47ZIFY"r q0YFkpItPPTSCd \p[̅yIr.ZXYi.B՟ExbI3^u,^fW=]+Z|MVm7OƳ3etDe L37 2]>ejN\Fd9UOkeYe\EeSAڟfPo wŒ)].FF3vNV"R20#nm20.1KkﶺmoNt;.o-9 \LA#$gVt+*hp1–. ře\jNFюss3翲RMJ@OȤN[?0vzwo.E9$r1\),x!Wc v:N{c!q‘ܞsײ ;HI1![r9U^l'ߛx~~GK0RiͦHr~bˀE9 |H TUAFC  nH$d[ n~`ܹsiݴ1\[׊9]p)##@Ij>^e{^9ҲKcL۩XH "œ+<Ǟ5c*0a;12+,,l0E܇x;Fw6!7dzqtf@=bxף/M_ߊ^`~nx$'xV{a߃̫r:98$p4pN9JZ5KdU-U_U m+fKKeV/RFT@kڭ Z!uvY CyXS+ŷu5y6Ӳz=WnN4{ym4^YV`v |I,zdzp{'o5h c`J>A#G~DCx#ᆑk}_j:3jօ-|**.7*nO7(|mneزi._2>ho5 i.I[!*ڳ=5\<<#̳8(PrPʪ)$Sjh͚q,2u.i5`"ޑWv?a0@?"ڔZ_O E{e,N"Cx%M{g4KKSo[xsi>=𧄵_Z' =#ݦM w_#^k;[I5dSh V`)mZ6dfj~?'8dSI/|l0ZFVyAVU⿎?~L~Y]Gif|sF`fh/㷹s3 ȕ(YO0R^_gr>]]+X>oG\\735w>0|:/5ϟAN#o0rv*( e:د u>1OMSZkNiXRKk=2)FI淪y"[Kvu(lJ|{-6|s? q;_2Coxķ$veMZiӡ {sy$8/EB4:vHfivi?Xt2nVb"""Q$)պj<9.8ք*ӏn5{S$m>%՞n~e?_2Ιx{^O5("/k7`-?R]2swq/Ɨ'mgБ/h"x\Zw>H{+-FG U;V'E>ndzޗVg WO%SM}s4nֲDS0WA㽸Y[JLTHVPīJ *T}4r]촉Hʍe(Ld* nӴp>Kw^m.Q-^C O]#ةbY_z[xLסѼQʞ!eYЇoGCOp𸢌UL>>T>e}G.fm6̟*џ]6VJ1rqz}k՚zom}@9 sӷ\yEMZvjL+F[, XܨX i5V64&PW8$p γ:lmncErm»NW,1Դvz&&o%+ƚinK5?%9ׯhƱ3'Nd Pc.Ko(?Q\2p0v цzGd!Ig;u r8S GR5M=tm!䄮v9RyDǖ3 dWW,;-6fdh^3ק-ykix9wéξ4j]|^H"Hfd^k-CD񎹩?[[r>=Kr0l(;yDcꚩ57Dׂ3$eG%guV !P "Xl;fi:!}x7bRX6d6A I6[$nZj]kQ~_ѻ%_JնajQn|Nݐ9~ڶzsVb„EPT"P.h%_++UKE1mx\2F2̸ѷseXQoF. ~Rm\n?;Z۽t?&W6ԝ}鏫פjC*!?y%@V;a 4R[٤값J"e:)`v^*kCZg:cl;hb!#ʔC1ldpT:]C;*;`28U.ܷWK^nY|3t -.K:Fmje]QDXWU2.܃F{C͸*Hgb8 ^rsf85gYd>!OJYc}r@iVu33VPjZFΈvN\<`윿$ssMRj-,lmw{Z7wdWׄ|G |$c]GEKĿK.,{aHct㴖țQ+RkxZKB^yc2?wM_K6N|mJ"6ʁgFr7uN"UkI}V]sߡqJII7o-%wZOz~>Ӟ'Ӿ=Hz?ÿ?>-x 3n](ЬG#m"n%,J_ [|-t:m?"|N/r2=2bkWҋR[m..~ZD1u__4> ĖΌ,w <T-/E|>jnGs E)CL(EHgŵ2j.ЍI(^崬޶E5}0N )֩4w͈VNKQUnJՏ?`;a?i&sKuʛWR\oWoD|p XxSi,#<" $ iRoʰ^j7C͊$TA I.Hr#13Hw "αnUlQ n<]%/Fd"2_ZI1iȑBYdE<+-a}fw-m *iZ;ʕ&iM+Ys;WKS ~-~?ot}T}Y&oxF*@"U u`0fމe&5_otYE#o敉f\08ߵW mahw:Ï]|դ?mt=3W>MԠo^ڼgkoon__M |+^%OkGBoeK@,4{Ȧeȏ/]}cWb +ʢ^X/-$UխG[~ȿgGվ7CoO| x%tğzG 3 |,N/lmvh7\]37ֲib~c8iTnq}>}*).Rh.QROM>E)ZksJi.F;U! 1#Ƚ -a~@xt)vvQ9}^[%y&hLWk  cN4taIf r Ĩdsߵj2Ӻo[^:~>ovzιejf 9*$'ү>حEdiȮY POа܀y$sr;F[;Ck, a${`1!r* G߷wuON ݎI ă' Uohu Q($d$)8 {tW62r1Ӟs̺/H bH*pFr8pv]Z-z-7^ܫV.nZ&msz{fk~' {u޹뻬烁OR3+F @œ{cڳ1==>t> 4 ^}9^u s!xFpq\lA 9OsU[;ai \~sc߮8=bW#tXwDdՆIA83uH6O9L傅E8$U t;Eo~84{vybf>l5|,i1j2*#co͌`]E}uK[Mn^zmꁣ(<2NLTdV'g?[Žb{m_C*yg8# ":Ɖ+ *nu_㯆 ߌ>5R &@H!IR7m4Z8X4ρ BSkz͌[^%.PXiD$Ƌ.bu?2~'xyALia'eBХKH" o&[X"l.|$'`O.3sp0yDd͊5fN<ғmvs{nӲWI-.t?'τvÏZ~-Z4V'rGnf[EmoÆ/?_F[so?.4h@՞-ZZ$nLhkO럳ٛ^e^K ^FEn4>G2ƑxK+:KʐZV"ٔm@CO06_YUzҥ cjr)SI{8Pmstr:R(œakqNcV[N9zT'o/hW{4#9'~# yͶ{?EikA4Kl,ap1,SM6 |w?o |&5Oܧ`A>0ެ|]2eG@Irx- XIb \3vo x~Sr3Y).3_Ę/G0bo޺N/⋽ݝrճ<. M'QI7VKğ?#-{4dZv k)phD1J=R3V~ *3фB2SUYQrqomV/4]aMc=ͽ#ZZ8JVFyoj:Εv-SoC͸q4~dR5X !]Gbw$ڻ^zk;{xlL;ܤnpNm徊AR2:9luϿZJXV@ ̙|ТFa@enw:v `|9uks}4rV,dr3zm9v .n][dI&D쮺&lIZ<ͥ'&{]k;6P^ݔjo~x5әWX4[& 11:'@VڞOxzͤ1"&Ah|=EF$v݁viмZw$z'=7xGTC4y^&̀wOh:ރgx“k[PdKT8`AJ22yq9Uir&sN| ݲyRNO`8i5hzk饴KWF.IÜKJ<(~C|v*-bإn,[b<.ޤ䁃5H8?Oqیfooץ?Ӝ P[ @2#3WwzZy[_yxmXM.]"WX6RW)Iii{tUܡՇ8PU`WoΏj#L+r)p+>R(wujDB>w Ł}܀p+ru[۷?&u^Mf{۝Tx!qgzV`/K1DtwIoe~lUվpP`AFRH#5n,nuPi@WWr#fPt18R=k{da pw]aCc2pI9€@'5HXjv:vwuE,:T8gGދNVO_7UJWI[~]ߕtJ}.^*8ĻbKFA V,Gb+<,Mn)Kh^>|c#eonQvV/.wT0p4?7zm_o$gS w!dV~T;$ǿSxT͋ G&$"E&\K1P[{x$z](ꚑe5yEFd̅Gm!Tj_ CZ O˹ pb$4Qت6uШap+v;6߽ޝ%j8Hq%4۲wMEE4V$kAҵgVMƳ!vHBcPФ0yL_I/G[ ? -7Mp4q?z׌Xϒ^DF$(Dr__=G߈%[&6' ἶ([puON݆M'poCd<8HTF*Ue=zyW5iinwPXRi͵˲٫;|)m3^-K㿌 JeE:l=<afgѦ~|+gF> %?}(QMMXQURKMQ-̪rYI,YOؗDCG~Zioi gXe}I/..^)]&%؍ [Zh<[߄?d/ٟǟxW\o jmkj<8ɨxghⷷ i$i(¡CRbi>dՍe(ɦIEB ϴE'ug[2j|e++tGK' ,Xg #1m'q#Xnrq,ﴓ$q?8+ ~|&K*xV$xυB\AnWS֣{lѳiEc_*5~.]|em? {h:b1cS𨰞VHb"xʹw)s"Nl=j~nWV8FI?uRRZ)Y]5uc:[A98?iF3r/Q枑rN_,վ'xwdEU?Rek[۱(oB˂=kx-İ[Bjɐ-񯇮eq ,f% p7&]K+ߊ|-P.#w;Ğ0֜4ˤ;w!~ӨjOPXIToּ-j/E6 D]Y_9dO豖2*aypEe*ҜaˎIZuHԋJ8gMY.g%8/y^UY&eƴ0jZnJq8g}TZEyjQ:I4 xyarB&] ~b>*lɦ(,p=qrN8`m(bkSJJ{+Z|f(K<1"\EAk⾇_4پ6tLźf*\]B(w:4Wy$O1+TXI%(9lZrqm<>}nѥ`0bx|Ji(U+IW I꒕֍ݵ=S[57LKgV8e._>.@]A 1>znko?"|@3Z//ok?Eh#orjCrFܾC㵤~$!4fulK 1y&YGW.Ceɵ ꗜH U#Gr oKK'O*z884K5tZyjtq8-679]n1M&Ūy_) xMOj7zP-[+{#a/k 뚊_{P/ ~EubC{}4Isg{͍ђ:[t&}ǾW5-dt`v?FJ " &pkR!u*ѼI_Y>mj;#l+HEo [YK_X7uXQ~Zƿ R•ϫ|<#[TV+m`,,| ڙAWÔ14%aT#(9M͹GW&ݛNF֋j9&p+GqM*qɺS){)^nJ f^Od eg|3iWBIln: `,V0M 噎FH$O<_iӓL<;6Wcl#ֻxQRe3Fdt)-s-+3+F+dڧ6InaN+Aӓ--oz[>VMEYmziZv4-Is랧ON6D969lqܒk:Ş\y:czAnOS\\2{{|^_H`q湋EO gvR\;WEw28^xջRO ۓ5nKoy 2I`2:H=-O[Ld5<#ZĎ03Fx,ЂM!rRۜ<>}惏7``܌?>+jC;Ucd}oFz{NltM n$랇fm~Ŗ䟛'v 뻯ӟ4>u98xn17V)0H9Qq^캳l|ej?88v-з uk`I#dcP=o^FUx[BE?b?̽V26SHVH;3cUYYL_1@q#O /lԬչz|kdy;#/IYdhC+ ;mb#Riw =wy6iZ iZE#xk)ǹ ߺX#kۼ̏傒Hd4׼cZ_inЉxpUb<*9e weOwUm^־!,sx HF Ď!xpd HCJE_в< /٩8>Ng;>謺ik#_xL.#Vu%QEXekVUG?٧Wemk᷆]Zdn<5ŌQooh4t!څޫck-um2 :_?c~z-[j_hOz7-xWj(!SNq-C oxk5Գ$SW1myV[``FϚk_ڋ~m+Z͜>/6/4ǥx/$1iEvo-C&XʪٔJ>Tu:lR䦥:nU*49Y̚J\тSR%`ZVn Jܱ򟊚%>~o>rhLқhg.%GB3K|㾣{o$Sl/$*(PɽKd*}^ Ğ75h A ,vi?Hau!RA$I*ˆ>cj~/74}G-@ݞDqD[嘺b ,x $H_iK%)6޲oM[w;'yb18ϩƊ=䤪.UnT֍-=m_oko %?wocoM_Iw,_DTk,Κſart]tHy$K{8~4mo>5a\q 4qLM7݆x^k0B Ž̯2NbXT°AqW~1į_癯EkKk5*%[-vD8(ʳZuUS)s{IN on]\kEsJV33fUw%̪)%t)i&ە+D0K5Z %@[{.ϚfdzF L0cO/_4M \>4Fi LĬ.̽ۅ-"HX!_~? x㇉|u6IgUxtI8ehbw/%jGZ^hc%ĮbO6 yp+Wg K3r(WRpDf䤽һ<,3L-V'y{FK-IIm&? +a?xKUD%;iZ$`c˘c< 1.ɳ>y~_mu_ϊVjC5x͸)1!O1ݐSiC|jڧ_h4q<챉 "v.[oߋ 4k:X|JY`'$)ZwF3U,>YQ&+IwO0NǶ`Jf |FMN}J'Mm 1̉U"عT4`Y{~XC5ibG{iKe{5't1+6x, E疖&kyB|ThwNj?{}#U[8Dŵglj`@l.[.;xE_eUMAr{ gfg&B71bMc.:8T^b{lcoXhaܭC8%nJI-29,>/2l4aJQqKK.H++k]뮬TmE}I_Tҵn\Wheels Waiting to be Finished.jpgCDataObjectRef FF\ Embedding 3F\Data Object 95V +`` ? ?`V +`` AC:\Program Files\FinePixViewer\Wheel RestoratioData Object 96` 2Z0`}.<<ContentsImage1"Data Object 97` 2Z0`}.8E`VContentsImage1RData Object 98` 2Z0`}.`V`VContents JFIFJFXXC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222<P" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?qsS Fw=[+w,xpZWtQO`_DQ*.[y )d.oU~2a_Ҷ}: g>j_Aelsy{Ӗ)[S9|?w -y]1YNgi:׊mWZ/b=0nSů_ MgG,יl i"B|ne|ϡ4tiX*H.#WWĐc>r5'v3woLGvI4E*]S]+)u ĬCT.ϳ;ۂXG xZ?._I.lFM>%s#1ו8 O :gZI9o0;+EZ?Zk'vֱ9^~[?ֶ4SWS}_R1<9UKD`glm*n┪Kf<js0i/7.?YIqH.O2Z ~UHkaձ7V:̋:2I?ޝv\eS][i%%J7"Oo;$6VU:?ZV-AukE)Xs]3mFe g}7Gl12v [R>W$m ;{g슺l&˽pGYQ^tXF'߿Aɍc0@JXǢpZ?%e*Gu0x őXE3~UJ/+sy&ܠy\b*ZIr@Tk>vD6HǙ?Jx|B4ry}?Zl׷*09pON*휮N{ٗTsW1xD{}gk²*}<:Gp랹5%8r w_z⮞6ig*1ZType=SI10 ID=Agfa ePhoto 780 TimeDate=917672539 Resolution=2 Shutter=33333 Focus=3 Flash=1 ImageSize=640-480 Quality=51 Strobe=1000 Again=123 [5] Rgain=557 GRgain=270 GBgain=280 Bgain=392 Roff=54 GRoff=52 GBoff=52 Boff=54 Blk0=33 Blk1=33 FWare=v1.1i OTP=2.18 C    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?( ( ( ( ( )C mXPdyjNVdl`hM?z 7}z: |õ%;[f'Oݥu)Y WRIbs֦Ĩk}i;nr޴ʮBRyڑ@\J[o+dLV8^iPzSXlSf|tj9#?P]7yϐ#m!h8HgvN nߙ~VHC ڍB#zUۥO6ۈPvnDbokԻFߛvc#I NJL╗g֙TP3nӰ?ڠa6((((((ndDا tJjJQ֒s~iQ@Q@ ޮiW~SVy2ؙl[}dwTx<թ:dA' 3\ wU*΃ȗ/sGv-Y}̻ձK熧HʨwO8GV2Gj8MQEQEQEQEQEQEQEQE:R6W7~R'U2ʨ:nAal"/DžrIW3`Ү!6ڲ]EĎ"5jVe?WYFFr $JYV'o370̲h?KBtԚ V(gF갺b"˧@wYG{,kkʞI݆Z9b݅jᔏ7Ln1oVu-6vQ8 (FaXц!rA3B[9CsSR*m4U425x~eegs!ƴJH> Է+0j{ul]0AX猵z&sT\.E)OHegmjY|IE*:,X j9N&2WvI5m{V.* r7e%c+nz<Kyӭbci2|š|Jq֚NJϩR#ݗ5.. ۷ǔ۶*. VY9梫+{f VO,)7Q+O.j4mQ@”Q@9IJQ4r+nViӋ1]yM)M )iQEQEQEQEضuţvϥ)lL'YgRѿ˝̿V;mFlmdjScE8}ԭP-Xe~&T#~S__&s|+y;˜I }R)7FU,/;h”lnߖoJMt#] i!+76E;oͅh)iR .HAh((((()RjOIwˏ+6б]"ILj7~W5̒*n^\Poiէs檤ɛWЩMVKv' Aݰ=^ּ9cG8v̉p}ZiMnфڋ.Ӷ5lQvnU7ʄӰVo>rӲScbOzԢW>7c*kfU5$ֱ.f>[0"Vai6(mŠ mSQ(FNZBPWci1J#ʹEYm 7dܫIF?qT)eEM YYw3Kd+e88_FAj"94+$w)>11i`7֜]N0Gާtg*) JqSX.~_K8޴hvvϳ˜mX$vڨXԃ qNyI/J.!<Ϳ*iתU7W3R}33(o \bec?ctT6_~rpR/_jh.CFqWʟݧ͎άſ4s;)`RV ٶ ŢZw"V^nO>P7'qU4+ojvq _;삝SÓi^qF"4mlT"lm[)G~^?qXu=6܎D[92 vb[vTP+$*R9ݚE %2w]QfiSXwzv-Q@x^UtaXx ҧ#v$?V4Xiqn2$ME-Ko]=iA !He/ PNF`c/s;#H$`; #p$16ݨmI6x]|ozį"D#7o#,HG + kAk}3 =2+Cbx&lZHĎTL̠քQ[mDoS `ܽ!\c}ڜ~MݓVij"9!Vzl(+~_~[ "/;#Tw+Wo'%Po՘a,mq՝(_VFoe|FWަYWtVFgRZD%cs~'FWN173rAjV'i3 Ii5eq-jD ȹ㒬*YU1z7W0.,>'vM͸kheO.i"GwH#2$-m";'֮ RcPG3p|I(q?7Kw=DYխm#e%RP xL"-Hї?cxJgŮdsjvLJmoO+iԳ !Za:jvdecl2<; jnCSeotݴ[p?:~a?fF4>7SD.O5>yscV_6hU+*֪m6z[e};-`>l='tY7&n}6u(R n?cSdDn_S_JҊ5Z[ H<Bɥp+G_s=V'7mF`-ܟiMgQɗ?wu2MCMޢ=9M֞u-+4SqćAg@j9ڏ'"IY8.=*?mTХf1+^pE77 [k+/ݦb ,ZQoVOp~|UjÙhR9 \(?*hpv+ۚOX6q +v=ʓr~\Do]I+eڕ빪G*YX.i?n_˭UhnJ[7>#֝%ǂ?٥[ၸ´1sy ̻c֣:}?p~uk]Q0j:Ɵ+;_,ҭPgbL]QoݯN; )[,Z-g=#j5VV~jS N}_c?O}oե8]:s֡֔<}sT}ez}IyjʪUFg;/|ҋYA&vK TI3^]썭.WMf٫o9aӗReS{57a;>Kme]*ȃhpbJUUvVH̀4m0`OJw_?o wz.? 3ңqjg#>dz7¹A)z۪Sa?x=H즑Y樚AXi=FQE_emsWuQV[-˶DǰTE66Zg{JDVs 򒫹fAlr6c1|Vu?)VV%eu Crx٫2PYGZͳp>vsMZ#A>K9"iA Z|(i.͙yr6?Urʊ\ZvNdք?2pKm3DTZ/vi7 ԛr?Ηi15VgdzU]\lj+\մeޟTXp,[ըSbj~~VvR$v~*9'X{(nLCw\s lR3Ue~[0ڇV'uXd62pW^&ބOC=+^d+F+L<_UOVF/]9ekX7Ǩn$yY69eSh[Mk%P p=4-NDܚlJ7o[UT)G4{I3g&ӣ?$ n6E3]25ʋKH85oaz_Ffo8eV&迁?t{F/CkX[d^|Sm?{v"c %G?~avr/jrõڨԈW[`wGƴ{VV(h輨%(Xً#Y~Jቓ=DW^6ruS fZf#Đnu 5 mVS.3ɮ02*g/{a3F΋63Vβ|*>^c9Ю|J_Ikn7֕__2vm1^]etpĆù~;=Z!a i9.c?PipnfM8<UBd~Z?D}>jYv[ [t9qM=|Њ:|RzyT9??֐ ZI*^Hb"ʵ.!3%{| `dZAqEcg }Ҥӧ--H ʥsV jvevUY@:q0%X5c&OcVZOv'I-͢]#tZhH.Jz! Y%G 0`jIvcCHG* 4!mcƲ'Fo2QQ܈7ZkF+v]5DS`2ꬽT#-{Uz&k_qh0jV`y[=bj n)vs5*6v<)N@Hid_;|K4 |jZ7jɤ&%]Vh&o᪶kuh6;I.bJM˚d$"Pz&XA5}hnIDA+ޥ[lø%[1XF}Ȼ[ yA>Oznr;cn4ZEfϣWLkSDٞbҳ r+b{l_X% mݪ-9X64>J2vHymgWB+7(?!U4KO3M4q˱vXnn|5_ۺM>>HپVguKuCUWw[[fw[(U(zSƆ) 7Bzm(K{gWI|lF_]ӤD1Mf3"n٩IjˡW Cmp|R=śݡausY[ԯ."%fo-I᷉0v~T1FB~`[{~MSȑ>FkG-)JD|5YXsw5Zy9xoii B7˳IH#z1/J +}ju_9Q:ԭ 7nۄS2Kn~v66 Į ve_1tȣeUoWn'XOZh|yHN̈j}iLYbEfo7_复Q Ե+ęmCqNdU۷uOedx2R꫱|^oѩ.#zcw ԝ|-+9A|!if-v_ ͠+_I:IvPJseW$\ȭn~ߙ+7P8#KU]\4; E_i"2_ ؟Ջn>>Ee<Mޛ粐`u%ĉ:E,{TR6W8¿6ІKc9k)YRy[uo֥[ȅPn.ڰ>Cz,41S 6Z1i/l2 KVgG[5f]|rĻ;:E妕q}QU;7Z%ٹSRI0nNkm0Ͻڦ Y 15eou!i2;ϳ#lO2#kr26ĭڥ,BnOE?k_jK17/M4wW1 {5D$Mh8Je@Ītm,>_ſ j^Xr4G6Cr3M2PRڰSUHMբr+ 4s]rmUu]yqۘ(ĉ;OTZ1AnE_vX[nڨ|'Ef>1R[4}SҧX mYT#B(̍bi%E>~_~fNd3Lmvw=:qrVGK.(.dӅXt+}"ivuf+q69XezVrm;}Kn7οީv zUF'-;@Cþ 65HVUں ԡc88ݒ7YiEʧj6zt7:K\=O*>ъYˋ8Q,u;I|@C/xI :}sYq;:b)ow?I>pη =1*;z$j~i~Z2e_$-|BO}rq{`h݉J'p֣8Uf.,ŜcܚsazC$E4NQ\jvmށK+כLU4|9֣D{, ?t栃YyEK")2n#Ȥ.ޛhQ \t$ Vj>#F\ U5`W>:qt)&|w"YE,Rm?ueGw-f;NF$矸q:Զ+?qlx^70Dc+t,f/oj**ZpԔUl!xUᚳT,tWݝ˻!R6b7ʱs7VDDgr#>GzKitoa'hNUx^b>Oiv( +#nFn]8XJ6?+/j7/>C_wykϫM- ]9ԉq}W,i ,˷n붱Yu49^VE"XoYZv;iF&/i9Z 6vQEq{ Fooݫ&m÷-k8ͷnTIl}n[7=c#in3<2sVqt%w[De:沬ff^FYMC}SODjӺ"cSݷ?*m:B۷cnwY&?053ф$*Zq02E})6LT(}Hc:boE,cQ `PbZ34do*7wc0FТlc*.e`}kN'[pY.nUv$NܚdBߥVis?U[#lm9^)BI y[YZl:۳'?e^CT`Tc~5kJUV^ F>mw " '4^FNvyj+m`ZIc`Si;ui%t[ap2YqTkmYڧluF%/4r̶϶4 v媆w1S[v%WiXi$[1# 2 wLWHUXz.E&sTUwDےFJKq-QuƪTZE]`2(aE,aw v"((̻N),%XBV>*{[9f[]WAge$}mRV&4,HҹiŸb7ӳ[~f 6r۱|V,[9Ita+I2nnSpo*;зԣg׺8aԑN(nc5-Έɣ9fM'O{t_)w9`NIP~me];VRWV#'t}Շ <ͻ%tT8 kBU/5wRq&r}>y,iI͉mLg1ⳮE$W(>˹*cui]fVW⣚?'|*rL*,iv=*5Qi 2fT|ɕjV·l 7-V>-?O>Ҵһr~jmxӾV۵)Y )wlj"ىKn՛qi!MMX,L՚{4m-?$"zGkqȜݤuo}3Yi B65vB%6ќKuڵ6J}ͧ]lѤgu]k$Co/M+݊vZd$TYWxqwVi @rOdق#y;2*+nSiKejͺoMq./RP_+?W_.]>nѻϻҬʬnZN !&7qU˲yjЇV'q $z=*Fx⫙%fˊmXǿq*ڬB0mknSL>`Xe.vy+5fRRhO>f28}:ն$fe Q2m#u:jI6#j 6ݡWTҲck5kV9[ܦ4gjO\llCj˻ ~L%35K.WkN[Wm,z|[ŔXcUA;k дd4MI?ά&BÆF)UX Ȯ~UbVaodRep<~$֬tl'̵auYncY Y4_",np)`yUխߴNFDn[pcoj3\izR Ĭ݈s^e1o6>l{ֺo#]w>MbjvGg8=ͤ\ԭaYRW@ooF6*0RS [92mZF6_.r17Ȋ׭o}Sk7IUeۑʨwVӫf'}I!mFn]ci$ ,V$mpў j'-˴6G NShfᮁ.?IW5?nxݕ(\Zefi_+ƠXݩ`UY;Kc7-.Vu*u4mT+~kUߪ8w?Jtm1촸`aHҭm-WGM6]b( {S5ǐGeN3%܉#,OV v .>W?0(/oD5A4 dtVe)lEE)8XnF ?Xn!iD^CWҦķAӸ*k*f;QW5C6"~֊D?2ʷ^˻˰VWިD }w5Ma¬&v{j}/$(XDһny y)-4vV,7O(l1l#ٷuGYyTJo_XJm2PۿX*հҍ`aVH"M1 >Tii%Kii{rf"Я λxdkg^HQVkf*>G5}Ox*%CmZ_T]亴l2Hg_5[9ݚ>]mr2u1KDF(ER;XnR%Eovk[Hw.w}+*i]%jՕGb#7mHke.$+h3vRq$K"7u1<>d$_(gQ{gk-Ƙ]إ71e@=jh.ܮ rIq7MPV그} %ϻ/PYJMUpV9nѾoj[ i$cWT_6Mi좈 KxȿTCU337JM2#!\VIkm$\0eIRRf9c*w"n[x_"]jJDr4tOMm)RM5` .edG?5I)D* x͞:$Ɣmfh R6TK'nzbQmE9՛'Tn!ί/\Ҕ.U]UP]q#U FYy'MmJqAZVFc9`ɭ 9Y RV7cf/5W[l q}Cw2(I-NfkbG q[:`|̃w*C \2 *}]MӬr1ki yOʲU$ž2«r)_bwUdMڟGc}ʿ/ jơTnDpcj2lܶĮW-X6̼qVG~۔fդZM+F\*Ыjy~U( -ިl(U|9g޺#$ļȠWvUЭX-uO+&hF]VnMNwwt&cMLmÆ⠔$yVT} Dl)k94KY V0Cm9WR}&hLUBɳ#y늉&fcRr܍1:XXi U~Z[f&i%qÒw2뜊x4 EL"C+,e"哱Mդe,=Ks ̰H[5O>"~' 2~2jy^FWȢ-Vw )Br&nceaK'"tSItPi}Vr] ܷl[4W&+ kj&k[|YqM?c, +HxRndYRM<- ª}jp&;U5id .SQPgِfc#C.Ѯ1Io}w`wO3qf6ߺx:$,n7UKXvUϥ+F(!(r+ٞabZWBr;/0r6Y)3bV8k򃢺H7wK蹮`y}??OiYtWxSZEe{XÕ 8[ih0E#7XE.cE(2mh+Ka}']R|.4pBLmcׅcNu#z=HRKPoҋ{GGfy\Jyٵ-?e=i?'|I,tfUlMK{;SGkW*h4- ^A-U# gvKflGBY.bbpJnmT .k: ͱb$?5excOq ڼse5\ec:PѲ~Ȍ=:M#Mc1*5jkhe!ZV\LhqnWZ}Mm,v-${BY! Ea5S+rTӌOZ+ncQ3jYc6lCkk g<ҋ)eMؑBwVȆ Vد?/ݧZm Ij271EvJd5~fVv2B_vv5{*ٚȉ,`6nյs/]B>DV cYe%jwu(Ghn.޹vamݯg>FhU=1 `Bk(;X &\01Q<5 ,#o5[حx%rgk{Uv[4f^kѭRR?SY2*~hp,k?Fl}jͺ UQѲ> WYx+ HrjJof‡J4~SsV<(xcwf6=Q.Ivɡ' Z:I+UZF0LFJF6dIZE=PZvPȻݠF"[+KO8n*B;ȭ o!Rfcj";0g3$]`ff,]jΝ0䲏׊]ڍ:nU|n s&y+ RG̭ЀA.n]Nk%kȥܭp " ^>K:e_oGYڧ/䁤qBqZi s?m Ρ$l#MWG{FYdfa,gD?7{); g5K9ܒVuhsϚv*;gG[M-ƵE#3N>5Eԓ{߯ij3( -3J*ܞiZ#*%|#صM-MS{򻫆oj%:z1Fӂ҅סKOmL\o ܧ+4mٱ|ƹkZTd]Gp۾eMԯw f3\-K>i!ڭfiY Ua[@9Pɧu"ba'suo&&Fq-ZTOuD-x9Uܮ߻NKc%;RXڰےVc,fk\܋T#?'+DGx\2f8ɎG'3:vk QJBc\SU1hN17lП8;J뺭\3*ۤv& oqFwnZXis%YWvPMs{>TXUT.)d,cڥD.qrF̆O]ݶs]]Cn-8"E#p yFҖ',?%to3gҸZywdv+T x\Ncl; p~W=$;]׭% 4oeȉfec"GҶݻW(Yb] [˵g8/N6#UozcpG3")?|;.V {g/2Y-TGTcMKXI1˹Jjь0{~`H\;=t[S*6tHr]۬;6j+E9]Z >$F|4E{2w@Y,m">u jf&y ]L!ʓ|㔨!K #ZkRȵEǛP{WuH| 45&Weo/8uđZ9ƬfP^R2M>[=v7nCPVSj)tFe~ NmjkxIe'li,w;,(U:JZ>gyʪ2.7 ɒAF Z 5k*/ ]hlE~h751m$v`R̵B-R8-]Sp5$R,6TsO6eisr @mI:C0[(c!>]c.QVZJb`pW;K mis5|/bF1zM&$Fڮ:2nnXdyʻzC^K4lg=x]HвuaҦ_eOZ.O<˵їXWE]>fYzzhZ<lwVDxlxP7QDcv)7<.2'zV Qls,\!ҝpøzPB6/!URj~Ut4xMY@.e-+4/ zՑ{L{?E s"CMb`Fby辧gYKET ݃ }GXQj寍$n[T: Q;ѦР|~Ok쿼O^:Ǒ&$N6E],kyV`oK7$ּ"78tn rd*͏V~3O"ɴλ IxZUOwp\z_$l96zQa,_LGg#oYGnb A,va=/ʛNoPs!VzqNMon̊_wV ~;;UclJ~$r}m$-Ǩ\b?*L-Sq7H .{?YN5䊌hv+9/a# yT$Uׂ0vx]rZhqPDBڏz#PmcQh9#:_#Gw+\h#{j}八rIn.ϙ٪˂/dZkZх-FDo*v]W'%XٟЪA!ak _̆C+欻a; r[-K;R")fX^ qRVEmFƪ3&Tjv0VFx#3egݫU(~$157QHdY V7RY"~e+޶SbOeF丏'kvq\oRI\pTP@p+ުnm^mww(O }Hd4B]DN|&WJ;)%!D@=>b%(Yc ]>g(vDc7 2:[$ cr֙RT._j%idx*~wߪΑ3ƇOݬ0.vBTmCh9'yma_*&XX1mTb~lUu%F"(|lٻ)2Y7ZNpmEʖYHkܽ"@* P7 s%!kI}UrZ#m>_V6(eucK~اbF%^I 3l'&ُ5`i;$ԔP_ʊEmFL5eqI G Wj֭&vf*Ƭ'FjŶRW0E]2+V Bf`7oXRI4xbݪ33*umاe1YϚw;Y7whUlU-Z["@R^p>k+7vLJw'; |;~^N) B7m@^t/"$ojb]24ѡ0D{8iQ}l#E_? j SU*M%NZ"0*6Uc1.pUo5mÄP=10yX<ȩ=\(m۪Jm;|Mԯ9cHeEYdi7?ĵSd2{zH;#u]e>djK@>֣ i,n<q 3GMt(z#.ۨ/lx }ѸԵgxn*Tġ# P?aCi-IJmP](kKbDDޥS |hܟ&FG-IBh\|ۻ +Eh܄(>T軱T&E8h~@kЬvD?bXN4IO+[XCYKMֳAD%«a~O*yqVBP rr b{$sH1 eojdpH$AM}kwk;7.caKU{b Ql:e\\[d" uǡ8p<(˵ ]Yda R jjeHz|/u;>{sV?QBd6'r}fY-iO' f>6' wjAhF[ka)z )9j;Sд}*>>*^dnjjぇ*WG FoX&I?lUtԼ$F:3ԞВ%_Zuy\%~ݧ+dk[VX/ƟkN[1щ;UxWu!ДľLx5hY_z5`r=>CMFhnTٝ7G-OV[V9|#<c~V'#OZο`YF~Q BU U\ t|**?|g#o2gvtj[=۩dxc7d5u?lܴ漋gߏ֎y:T@7ێu?#oc]OlɷzexOּ1JfOg,2,D)q].VkewOS[:*D+n,ִ8ͅVl⟆.t7;*D%?= "Rr˺Qd+RB㕹<-:j,{S{j˚y1 >̂6mjK[x-$x晞\֛Ժ ${|Ͷ"<Օ_?PeA5*:)cYU1NdGy6ڂ]J+^Kp-"HWk0=7hC_wK<$*^QJ5bٟ05.Syn².v/-9Ia3:5|-,re[ ͧhNsONZQc!+gVޡi Wgs\մ]#ʬޯj2BBʹjԉo S&Zz]Y:E"Uc^=JTUQ,SR&)Vo\46Sgwqڸ nsIM@`xmDckSYbhը͗WGwsTоI\döb5\ttVR#=A暐@Rrяt2MHͣÓedE/"M"GCs Ffؼ"ViV1o#ںO&X@Fp*?xFCޫ"HXFI8׭4谲6y8֯7[ThD~+{Ԯ?/*i9m/Gߤ!m\cnI'uuk{{O\l ,8lZXYn[$9 ƪܮm-o#0anJv-M/a7ZSWC:,F8ݽW[֩Yxn Rm&Sƙhc’g/V "ZЋs啑-M%mG!k,l˗D* r5sn;𕬭O{[1鵪%+Ƽ31$Gަprݙ:] O%)8Dc"n8c}4AEhRZ\|O9F#_ZHbQ%V(V b@ oT4}j#z?lv:/+ ]~GvO#öO^#Tn?Shh'd!I-s‚g+3S,J~44bH-цAYA[J4't]-ŕO3[Rw`U[a GPy%q!OpG^dlfS~j}+۔GQI*I^ 5@ƅViTg(by jf'@{f[t+Hҫ eUḨ+ր7,-{va$Hw^Qfs8&2vFZ6׎'ڊPٛug( >tLcQ !*N7+ԋ: ^>R7P\Ȁ\]FO2)hQ^y8 Hm2:~(0~eV*;ǦH6tz~YKKE+KQue4s2w ~^x -)m%ɽXSq:m/OtbOp޵TL VK#HTR߼$UYW~οݤKW`Y8joq*԰i[} ZUT>6yMJL=25ԛiiWcgUloLѧ[FݳֵcIt۫۬YmXvᣕ2Zs"}GRx~.Dffl!T\=ܶBV.jx& w^~c+م cdk0)`G*8b_+ŴCy㠪SGOorQBELnG+ۅ@"\ov?U bxYY|I-p0F~TϲEP)lRoEVe;cf-ڳ7-35!k ɌVRCģEھ"P?5zlj4^/sO};S?-Fڏo_Vx̿ YE(PO+xᎷ_S72LηKWZ:͈ f;4A-ǁuY]4YZ/?{ i?L:tWoqI+w-F?Į?nPԲ|8vș`2m56׮҃Ÿkw'|5o-vܘw je׼f1.,Ue~· TT?>jX{}~cTMel B*4|lDf*G̛zu%׻I@ZSԫRa5&xi>m3^U=CQT\㺹 {xGTx $B(ZSۄĵiTK+}bz+埻[jo,ee3%0"wJ]\ԼDt:671jwӵ+ 3VrMzZ&ߓgZ}sȅn4YH=kV!I;~LkQ_iƪVV ~CxJh=WB'LkY9Y;aWejjJO q ˆdRHŚ䱍ަjj}G|͟ hG8ѷlϞNz&@f܊۾jn̸>v.HO;gR|Fӎr*am4J*Pw~[Ko 37{Vn.nuڒ&*5J+BT7R 6 B1G^>jQ&[gI)x9% >g.g8!̘F)XtGS%6H/`n|"Bq鹿: 1h{>6/ehn[fugi]{J{vj^#f+h|RK lo, SY?f)'TIh>Fk֧',yѷY_4yg;?T,hBmSS7^]&D 5O ?_/n7($~jI R>#ic2ZOXstDOև~0]=,31T̙GmnI2i"ԷKPgVڨI;Yu# n7*$Q/ۯGӭ.c )=c*zu_0 ԕC]"7"Z3-ϖGUS`ub%3dcǍlv+5i&$aTǦᦾ'_ga8rN(`OkpT.on=i}^I*Q񕊓Z|a';Hk$uw;c>M4.< ޴Ou,|O4 b|IzTCz~ƯI v>Or.VR&i3c:rV2IS[; b$ g_>_AGSRZ"Ub;-MȚnf PSM~ks PDbڔwص5.;wwkY Kh 9?1@EFU?$7aor=&ϵ%E _=E]voZgӨ-v'ЖTbO'XlJW'Gt$ngW=|XW!|G-7#OɱsO.Ė|Wf~S#^9G CzZio2h ו/Hi񕄑:\5y$ &Yg6ZEf%?2ڟpx=pᙟj$} H+[]?y$'e,~X ?WqSı`T+nˀH9_P.#Ė@eO6]isF$7HV'%>*Ңy7eNWڧꋹצ#%)̪U#. ~6՛y>b7F۷-qrW@NeKp ˏi{(+v/*iب`wW$4+bKOáݢN0}u;([soZQrޮ]t $*I Ч-1Α;HePqg84hb6 '|>r\)gVҜQ$#*HUUrm$Lme9HD)vVA*rT+9-.e du~+bmkn^Ԗ6\-Uly^ݐd`v.Kqjz*/T\Jn)`XY_*Tطқn3-hp7olwYk8Gf-H|S&>un'ON Fݰ!T?!ңGr]"+{ڋȑQwXiv#+>f Œl V$26 ^9ܿr{%2*ɰFbH26Xk&N/k-d2D\:WY㑃^+I<?z/m-e-nH)9ޫ`Zn̨ ev1꜅Iس:'s! mZ YgnЇ|u='‰"m6EJiQeg$TČ5*Ώ2rWbp\_hJ\g ?TtfJBWГ*Iei.yRh6aT?6Y "||RmowoZۢI6ҺReĉ4Yzp՘ F?Z fB̈/(gnh_~ldyfGtJ[6D3$G8o>Ra&KWW*$v1OLGM*}Zъ%duud?2zչ y.WuͿBH7+24pУ'v6՗ ]Zn֪XImDrw4啑|n idH$d >_[U=ⲳI7&m'8 xۢvpQHcX*ʌ>Zz ѶҹNh :5^76&5YIJ&+m %~j|˳Ս><u])Dy$rUs5v-<Xas!yj1Uꌃ-pYNxD1EiՖ&1sRE 6󪺰̤yd`ToFd3ǵWWmI7S\I\5[c{e=y|}l4˛{voaiMEUYt茘;nOI9dSB=3#ն\ ڃji-3լlS+GS+JK|GJ[#(nٮ*DY \lpd^D't#cOD> dI6R-1\\ĪbvN+l,!;|GWfMz-iZΑ=qZU,k0HjkƨCoo$G+%OIqgeq#K%DASKoj-IjQd'!W6 slc&`TϖS)m6F8uXLl LxQu/nĜ Y3؍2€.Si+6aj'.{ [y, !c3I}h$KʼaԒޡg[IܫYSuoΆ井 Um}޵GJ#zWj4rِH >jq8ȎG0^7 ۾oJչsg*v̒eijCڴZcBPyͿq\m%Hǖ:3Oz,4K5:2^ՒXn&VP<reCp$5h8Ma߻яQG(Y݉X-P%) jpkZmMwFTw**2XT|I GBC)S`mQAE.*@37Ҁ"KcLmEq+GG 2Uõ6M7 R̭%Iʚ@F~[%4>դ*J#cI8Z_77fh[Th2ۣ\`g֋lҶT6S5Q!k{Q2HYC7޻ ..gFr˸|R~5f;7vUp}qmuİ1O"T|b?B +Zֱr D wUA4{RJY|uڭeOU+xmhq +jWqia{ks D?j,fV݇V2 6X0۬2*Θݴ79uY.-#L%7!>[?/.Mmw1WF:x֬C &aYj;Vm1]r6*4]`w*JwaҴq[ ǂ:Q ;mxie1Ħ+tXt~R\ ϟ-glˀIfPq@j &HFfroh1K6,225Ov./tO)ӯ_v %ȎXN !6XeI7{=71 /_)uԛȎO Ƿx,QoV#HԫBv?J/*E ATfI4d۩LWb8_ҵ⶚+s*KcVPM#˃b ,Ȳ}QRy220ƻ-xEiYLQ&[%VKQJ=>Wkugsor`'u%YUBn64jig>XL6NrNqW`ho<;*vV%?54Jf e0 g)FjyD:=Ŵ#~|t<~vdټo/ֲd0W9W+3 XS3,m`o\,r9܁NJzO5c|ێRg r$HR;vڴFzqȐ˵&dukoUz-5ZUM+7˻i~ʅwֆbʊrӲvVo+Uz ^JnԊ7k"m>+"˻~ˉFe~jiI$sB^}7mZֺ&)"Ez3Lʲma`TT?5ZehF)9NZr_ޙyV  6:2"=)ߵZW03n~dj"9L"MM=I[|Ūx>[mf]p*F#`Ƶ1Km uOʷ-*>["[Pjpyyk.vKڻznvRUTmbQXbr+=OHia)9f)>Kmsپvuܴ>yqe @A1? NWw"=>\jQ?ke[|=q;M.gXn/Ϲ6*=`ӭ- &oRjk.|+bc24rg32Y9 coOZPhz&KoC}ZđNUpO],I4|~~geXAd^UثUW*(Ү$?IK9^9MqW5>IR=VC U*aYܖV.ʶBㅦ/s]武"K[b91iՕx.P k9  +j= Rpܚּ%lf;\+th`Mmy4x@6Ǧ#Gi7!E%io"eÊ~DlGzxӪz/IM35̎1~\{S[B(|Y'U+֬:vi= +n87;qS65al }Y@)~߱47f6[uh0e[籏r :%K8Qpb-JHwG4;Xo`.wuj3W(_O躺 Еa﷽h=^DUG.Ѣb>+7%v{, bGBDR⚚M̒9" ?5mu&ccjcA#czds߂*jrCG 5zV{lqa G U'h  Z᥆kT$+R1^EvQ [ i#he%dɱdwbIReV$SNUh~ ]Z.d[kkwڒ# $rl#N-nK] ˍw֖) uY>WR;GށpMԭ+ ɝ?[G 1iVt*Uj\G"6 eJ-HḺHY"$grqq,kk$!owPվt Hf+ KyudOz­#Z\\J-p"\ ׾vY6p[ՂKm`rD*$ 8ÆjɳĬ+۲j $lwMѾ_R][ YPW#EbA@g<13~&fX!Ewg楩V$1nX,6} %ljh_%ͳp\ vZ┨R.cʁY"4rI;] vXqSbSJԮA79Shƴ X:̏wQ r\Ѻn,Nr1Eփ[x;!Gp\fCs$"Uْ)yd ֭5p%fsT.ik ȱio ,'Β6psDN5NVU"I]B>ʱ6Gւ52#C voW&[4\!܀mD,\2/7jkw۷ԭ@eZp?;˞I.WNW@МC/w66=5$ռQ$3 `0y8y%6W;HL ՚FE{R/H ^iU7rr̋orm]M 7Q:e GD!6V34>ջdu&/MɽA;}7Uв! ,^z,4YlXJ˖ RI3=ҳT1,-VQƨ' I/Zbu4 ?.*JB~ PmؤLQ'JZsjPlv-x\[yexFU#ԭRYRmێ*ژ2쒦 ~eop2]!ϖS~\cjmd2Z>LWRt;rZ雮_p]J쀢JnM]!%uq–&%V/VnhoʎNSd.'):­$O*belTZ1+exU^Xia XE*ǒ7{g;5$fmTtػwzxWz;#sv壙tBV/-¢;R|HݵK&*t+3 *L G%ΟpxY 3ĪAi "FKacJ΀/F Y5‚O-7?j~ه-gKK+L;{crC:n*ͼ=>a$m&XFfO.LMo4 ̼d tQG"\A¾P9V_qL_iq$qxatrk;pI㌀D(L|S΅i^N m޴k8xbMҹrjY-XKj1FkRީt}ث?sU 3B\[Ly/ɻkogPvwlсyMqpiգ$`,9 ǖm${ZkyQxz$_1zf6"@֭*$:{kFcDޢx$/ .5w]E֧J|RAڽsZZE\hz 8sfθy. Hfch:yЭ&4u+'<{h.DyQհg5TF"?tzIڴOY^qЧYl'W%DߘF6sB˵*hy #.]9^j%PNdžO5?/Wec1D8ǕOߤ+>l*G$XC jln!sy'KmslbFhě>diu*"&Q"Ne3Hς7tmŅҬ&>_ރ2}F:HܸSy4y-۹dq?.io,g,ڔ2_im]Fsxz~̐]%Ii30 `|OOnd *RHRlRvb#IDd`?Qd"nP'/\J" atcbD޹9UճUFt\ﺞUnB*Mde5Y]ehOnԀ 69jżPLz3@w2٭v8hf+{Y#H0ÌVl\0 .J& eGK|߅4j@M9Ryخӄ ]QSEN>KѺ!X@tX]]⣓iHbo0F'ǵLM#u4)(gUo٥~gЄ5۬l"f*1nE$3VbU ƿ:_ՔE{@YW;S:}s2n5,el~~7vDBJmMuh`U >?`q-؅`Yb*[ۃ+28@&{y$spԯo"FF7rrt Ko#]F[JKlvuz[yHD7# ( *KL""R3?/Wu1\xALbn]5jy3J6f-5_J#Ydydڸ^>]Ԯ5L}T!+5d@bx 222ܛkNm.vE;(4%0K*B2oG붝+aM~o+o?R>J;'sUyq*bh&6>/gb[GTlG$λ~ΎvlksnܨTZ!UҜue|4~OH,D)هPR7dQn#,1\-yHM Q][t0D2|0*;Y #yjYM"uTʱeݻk}Wi ڎ6BO3Λq>vT[3voZV2xbsTږ- W+,^pVnVsšl 'R)hey>gYAm w8U_rnۚǵyI!Mwz.怒 H&yXzetTGfMͺo6fe\VWV,n 4\HǭIk<7WrG2me[<s$|EZb?yD5\@ш;;F?SVB6`fۘV6mc1Nݦ ?ݬϵiP* ~_֬knuDH!Օ]D n]}Ti1H+[\XL̮w!ﳟ"Z)ceRQ6˨A,RBOgcMt[X&cl6|nc"!lHV⛆lΛ#`'Sķ2HJMػmcae,C Nf6ĬYUUhgAu|wc,O uWbLM5$Ra~?-^DI3Q-rˮhou֑W!F:AVI7TRۣ+ڹ8]=jAK.oFG?/Ն'⸖[kx7IS)*ZDYPF(jk%jm\mC$,Gv$w &./c+X:W7`L7.O%W>.{Pe4x㪵== "CiC*o\I7KneYI?)Fmn$Kl![gӥ=@;֞F]]<쑿ϲ2RuM8{,jT2O _)տ ͌18\7c6NE2#ZFC>#DzCFޭ.*ImÅK&r?Q^YO.$ W|UK[Mc!ե]-ս1 ϵ\nF "kG/W%mQ"f63pʍEcϝs1Vi{ַO~nu{uF.i)4dċ7߽L9|/8;gNo5Y}+Rvoi)1 ᖞamhs5E>&EGֺTa4I7U^HW?*RE&ٝaF ﹩4KXv7)IZmJxSu0Y=&-f)6̖TFvLZϕ՘ⵒ%_Hjm4m/XDjoRwp1Uͥ;;6UKku]˹}XiqL.X2ٝ(]%Ӣ,[F &G32M*u_Fdj-2s UH&In|_Ucj&Y&#_ʡ."[/LKi#""AIw!{jt/#Dd0IEn@Q[kZZsz1Qc-dlZ钮,QtMNHܛX—%ۻi[Hm풺 W+(ʢXiAn9 : n\Ei.(a`O(kD׾Iܒ*Sj ոHn%Oވ-k8N>:կ-J,8;+GKevmMإFi7~LZ$#2PG-iMZ\nձIug5ƟKOu]T1ݒ5m=wQЉI;C[/X;"fVe?jjO= vJ?*J4{`j[vqʜz5xfXdEӽI\uޣumsb!d]U 7ou[5-VM-ADhH*׵dju$_zh9F*kҦTBʚ2;ŧ"YuL;/.4b<-VkKh.vGZ6kR[v;oeضW#<1K\fXJ v[I3IڭdЮ<.%&ܻفeZ|#&frr~oӲ;}j%]Xb;p.Mض"66ⷧ)$?;E}}i6󼚄XzaTȶDYs+}-V&i#@G;".#]-jJ4\ymEQ䵹* Gahebiϝo\วiEtǺHg톮kg*+|0c.d.ͽXd]Ο{Z8o:ȇnI9[YlTnWI\q{$Ǹ,6۩d6ȯ1] L9큆8~MڽO$~k<hUXe^vb)&hgNdESqzVhKuk4qQXiMwEFgY?}%RbѿJ+; V3t0/-<8 !2 Bf.+8I3MjK(VF̦ukx>t,#?36kk4KO|yLTt~d/W(g~A R[\e`{KxQO|RMkuY}S]Dxwp>eRL3pX.KIcZ%Z)`ycTs*wUQݬZJ64?Z#eٓjضH!dwnL6ͼт¶>;ʎKϱ?u2[UU6ւGɸM-XE!|TC0?;oo,CVw/[DEG]àWdF6/*Cd{Ss򺊵uH yu؋r\ܪV'o#|´dbݩݎߚhw)|^VoH'eCS%Ir&Mwv}Ⱦ2D~]߮8>.ު72m xx45j]dgbֲ[HAqU=LV(6hQzZ{&ZǐQLX7 (ki%cϾݿ̿w9u%pS-m吁"-w+; ŠʻoO UfO1-yct',2宂 &ᤝwD2G A+})"&aQE|  ОwV}ewq4+yH? YuPыN l\ە^ⱢԦxdXϼV'sӃ۬+Q{p^v+cnjTP&ުvgSCUQkiuC8vz7ʹoxjW3G-.ol-d,&PCrll1?>vؼ7]6ɮ_C 6ih;WNڗNAs4b#{JPrTU5Af\_=h&e?3OGIfpko>],Kv&V\%L.mFI1Ѱ8\W%6}bdlZk_$%m%6_…\ $+'qPuAiw Z"ۺe7\4pX$2~ROUOVT%}MMfeEʫRkHd\r7QxmfI]K b 5ا̾l=*d.;ݝdړav[o%rr ʭr9v:b`ykR>ow] nN+Fc%;r!V}ĿvEg,&a3pG3h dG]h\xbXb;iSh? ŔI&TM_QHB+j]VeGS[>Ci6<_z{)#y!\0O\uH \ԕiB%Qu)=6n>h*-;s¾3U iб6ѻpsS M6o$ZdzhgY!T5.Vk,Q*.wZ"SlR?++)o3qhDn%ɿ掓k2kWL!"ݥҤ2o+H>sK[rwVιUO?jS.m6?-X~_Z2;uv9 RyU vE73!1y1*Ta$ XTڳF%Wr_X,ٵFmxC;Xnks¶&uPM%%!J&i>HӡMĊKs?..h,vi^;4=Z9l/o3r>~j]yyS}a^b lN0izRjm`ΦM٢뚎{|7l2nzʗi uR6T)gVN_4hEa[r$:zZ!ޫ\:?+"$n͕;(&-ei8 )Yk E_oJߕ$:_9G\ f[ho$֦ˠx V^CM3]Z DZT# }[ˊ9J °Ry!a"k_U})9*O& mKBƥ27nop)^)0۰~4OLJeبÞ&U+5szGK&,pȒ,@7W='Dcn? &5 ]\ۏT[Kȼ,/M]\w1tH|3x}i`6N*%Lfݯs*Oκ%R_xsgR#jP[ |gT& a/5!g,cj% QW71_2,{ւx'CtHVGbM [0rly屻YbIvr3to"K7&@n2vv8h=qpD_lZ &ăUI]ڂ[$"Ew|ZcQ+xue>18 !сJ=GlҘ},RZ4T|?W2~ߵ:G/ox#3;&Yv5jI䌫pO?i 7r$^sS`5EIvu@4+r_g1\$|y}hyR^ۺ <y,O".:v'yoܢ;:2a6q7˲SGJ%-xmr9.>jm$[IVjbP>XoZW'N>˱Tj#Iם٭=;kJ/ڐ&䔹REqis F%\-RWOkg*6 [/UaͼD"hR@4P}幹Y ĘV#pقWV; _v>u5^$o7ޕy=}_a;UH.1}ʲWORi)1@6y,2X@njݲRG%e'kY彖%,Bt}⼤w!;#kٕK;*szo}kvd^V@?hCrW*OxiAsBl.?XXpҖM>CL~m¹kyšI!O dcLխ+wuXXOQmdiL=q4I3F6eM ? ?ګy^IM_f `S.TfHP`UZr "*/Hf_8XQTື;MPZ nR ?HUXUBM((̬2ͥÕ%SSo& Nէ<@nXltZB*|f5ʨI +HL|~֯mo:?R噤G۷xԜȭDB/06ۑB:p͍65YmhĭjfCᷙ]zTķ6Q2*1 <O5YgVm63Sżh( ݮ9-3.X5t2!,y+6F۳ka5򹌾TdOm޸9[{F .;ͶFx%arH}ֵUE (mj4u#61қvKcv)Fp!WKk-3*>XEWP!xWGVW9Pev32k['FS̜ƫVGz@9w+W&mAb~fjW6dul9Re尫֬\QG%vq_R ;@mF([jr,7͂- EVrnm^ W-xuku?)|_o3HnZ.×ȊoܤDf">W>tR)c6 <~b_s8VVe MJ|OM)ME3FAlVakKews] _lm\-Oojv|q5.}^: ! RkE%4/> XdO`iʉ.;˸ sE0|U9.!/tLy̖i5G|(D`.ka.(x6|aUhVDYV$c5ji\CWL| n5y4yopăvUw$)t>W޵d{imUT JmGptuzvbVhWe>wju_j{mO6zNYkh䃉"ahNؤ]X'|,H#*.~b^B2dެ@&6mzD<ߕJDM#G؆`crSp!.6i_ 9mݗ+F5[XEIي:Wsurm,vՇߛmڍ7wv-Iw kS9FoZപde`wc :tKk  4, *+YОd캷cΔD k[3| PAu+:\q/Am} JRYB0弎b?ݵv[ jghgMj+ZR@X^v͢v/`Hc]oV|ehãvveVrە~ow}Rٮ0Inr?: Z" gDw5GR2>Z#ڙ-G!zɤ]B)oDUfߒ_;5r4NN۷=E}nSN\El`~zv~Ľu( d)/^&|]ռc#vl5K%Ŭ k]1ϩɱU_K̝kTk@ZE"mb؞sİ ڴkNУf;{g ʄU Yw=_*V6Lٶxt{t-&ͧkZ5ș?$7ʭ+di.WGsݲ\ *>R~Z^Ž[RkKO/O NvR!Yi)c*O#ޣرRʍ*%2\VZtQ{VD]+?)Pc7Ob6nm \~jM:`Z NYS8JNwy~S浼7ne\mN7Roe2\;`Uֱݟj;z ~jL%3amC/-[ RMZrmdq;gI˝Y|طc?*I2]FlɪHXq?ZllY qub#2!iiiPu&Dgh8Vtf(]\ pG,h[jvI)S~e 4?̅ l"32MrڒxM@P¸leKa[vl-[ )NT|$cq8.֭i4bIXNՑ{4ƫ&8%8Hf ' hi9 P| έ= D{A]V]Zљ1'ssc3PF)&C_6%W;GK+f7vFnj/ulZ(soy ]NY@{1r{(HϚK]SG]:]ِ3&pUS2^[ykOYr.c>k=غImVdN]%U ?z\ZKvW>v(5o469o{w2[7r$l Ďs}hӺNܓeGV1epÎȠռ =ܤ{WuK-cԭbi)_U*>!nt]wg,, hվ )0@$(c]΍5^xsY!eA+tCЅ5dCU]#*Q'+,b-jS?\>L٦,Yݷ9d|nܻMy6#'ܩ kI~QgV/x- $]fh-LMVf)q+E.sHbhnreJdm]Sm=rp'"?-,eZ{|an%D V< PҦkApQ>*Mh ܇dgk[Cc ]JV%pr M/VtF;:"2,{.щ]K,ڙ."d9½2HUdwi=82+Y%5ChHJ̧!DlmuVX Ffګ8J±?EC2 [HS[ɺv?wk9*O#Y#]:*e1K)?wUYS6v0a U8%SUxa=O(+C~N.w$o,d_^c[{l(JM2G>\rFrQ@4}$r4]`.9z}CLK34ʹ>kl2{}imFR3&@x5 ]nykxK4x)&_jeZLi bJ MF?ݫ5rKuzHl(ջDqu6N2Яi1۪ZfWmM?*+z]tvzھ{6aG+% 7̤ݩ?"/ >Zٙ%Hc/V6sh_X^#͈sY4uGU]:D媳/Q(d+XBj3ky}4[BcH޾Yw)QI]ٳU]<7+mƟ UbbV,zV}PisJh1-0ݑ3ZƳ{1{$R[95n9ӧc3*OupppI~]R Q13?)v̗/.ߕ76~Yx0~o֣]=YՑ'du՚ƔYJK0i>_YI{5w7M*at9"zWW_ gbтQ\7|E!^>Gkx,:<*nJ}H|7br^"~'ף+lG;ݕ_5k.XV?9NC=Bc<׮ng=>]ܭE%UWm=!\>2'ҭt}jYlX{Wmd7T,.ۛTb[i,k%G\[2̑%F'o`qGN+4vcYqN6ޭűfڌiyHS֦unwil H"Hloib ʄc QLf}?֤eY&PR䨶llt3-ݤ9y"@H{1]GUG sG2K1ͥ_+63\A%ĪJcЮ8P͹wwuR[ceV{Kk"u i :.nTu= tq]Y[N*Bd`JYh[jKSk!0]+aD\};O|wʾ`+:ޭi$I9Sm\lwWz-[+#z] FZK[iw|V¹JHR'YEr&"!, Nڍq;*i8&tV0̧o{[*Z ,,O~+Z5|ŵ1,+mVeHDn n~4܋8bM0-r-1fQ[> LAr}T]~(]@фWۭ.U락9YMjxݝL>mC>­#q&ob>Tjr5Xþ䑥Kv] w/5*]L._\a_硯9N|ѻmMY̐ʑls%9h~Z%TeRgW"+D1w=:mf'DAq8嫔kd]u7N]:;UFµG4T$٥qټK^OaUլ"E+ȼ+ӆNѤ_ݘ`qT)P]X7qGc̯Doy#B{lcOaVQtk|ۥ%0l)o6vVr+X#N4rA [`vOEgyU"ɽ@ޡI,č%s@zMjWM2+R-#v5,yƳl+t8XTWdiiHw/-o"ɵ*Go?eP۪jV)R蔴j 桊#Xd =VkvzTCNv!DCd-Lk'BYHCڎj¸ZmYݑsď.wVB7HTj_n5YcS 2r*ē8ܛ4QW#.JmVJ AJPEQk­t<]T6o͊j _kneMɱrXc,F<--ѨDᘩި4EVW-MJv/YToZq}v;?UL}NyݥmjjwWj975^ٶ푶T2pܚ"m^Y#oJ[ڕ^0#;jj&n6*X+!ǙUaں3[޹㺷Yc(иãӄvf|(.ț[,gړ+:ڪ.YGhެ"jR&Rw9R-٪_üm"#fnb2+DRKxR !ݲ-SXM${%5l?Dl쎣-U2ȍҹZ*|ʎv5}VVoon9$_[[YWґDVj'vU"I[/UNh*광;$ojp5k#.vA5}խ)@}q Ta3FьZ$FL®ިZ/5volfI2jvXG\ިVG}m}]ʯCaoJ>d=Nxz%SP"V݌MZ6W 戴Ep7թ(vi ޿.kU&̥˖ڤjǥ7 sҩWo3j?'{aOT_C.]?fVW6ݶ/[^D۾fŘ?v@cDw'z;,-uS+]sSn7nW(X㣷n&hpX|CzK1gkN;F܎~X[YZ9ןkW[W0팋;ݴ'AyıW*>wCJ^ F*"4ۛxnX Gۊ'UMm>oM('̓KUcJ0ufGsӤ6C*flzgIcV-cFz,1+S5DRܩUjE(#vLեoagZMo&6Um֮6BJUw-Q@, \ QImj5ο1!w ڬTƙBe`N,IrK9U(͹Wnb?0\ӬtF[,aҧcnګ+}R/Ib+>mvӷٻm]dxv#۶*ʿ;D *-iGj?ޫ١/wVXVі#+7ݫ bۇKu\SJ)ܾCfH4c}U`M~VcҴ4Y"RӺa1olbGi6⫖*>WgxR[XOSUHzfAhe˿ :Wdh7m? j]Bƻk&j\;=Nϖ2r֓ej)33T]ϥO Bږ?2mjRtm'Oz=جHQӾbOLA'vM+pm>)m]w {Ԏ!- "Q9k ,g?Wݷx1wenQ3MLڇS(>y;yKf;8 @>f[(9cv:L|Xc`J"wqך%;PjWghWq-Hc u2g[-\DWo⫈XUxY-i]&XϑZ<* U7'Sr;&q6G̍5(4\PsOiK֐Q79U5:Zi:YJ,maUY%+6e>ONHYږE(P*-PKqnjqUi#Ib&5VX=C3ﻺm`S R>=ZtA)(ɂ2GALot^kWA X/,7PS.?uOg=+>?YKws;p>B+g,7:З?4i8J6ࣟVs.LsNvpb8ZV^]vί*P[We"(Ɨk\"Y\"?\mj͍E$jQnWY2F^'񅣖~;VG]𿘇ՖQuew>ʈƪvT}*={.R?[ip~ vgB,nl]'`O :ujŝcZZ|D rjp-)lG Tն7z7oM2 n#5 4e מ)6w;99s^ +-R[4eڻTB=UcS^E_W1/6玜[[wL$;I)&$jh0[T-a髌I gϏ(N>֨Jly)^n\Dipping Tank.jpgCDataObjectRef FF\ Embedding 3F\Data Object 97V +``??yCV +`` CC:\Program Files\FinePixViewer\Wheel RestoratioImage1"Data Object 99` 2Z0`}.`V@fContentsImage1 JFIFJFXXC    $.' ",#(7),01444'9=82<.342C  2!!22222222222222222222222222222222222222222222222222<P" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?!?zK L7& 3ygoҠ6򁃳_ l!Kag6vqœƙx'g8R&{3~r#(i6v) "!+z⩊Է!L.Mdj:mΜѶ@>P f345c_Zյ~ Ȭt+su 4 M\v٫|AGm/@I_ f1=y9M\՗$w ;AWޓlwƦqekx,CUI ݳRGwq;QB '8z_IjvP"Bc\V;;o瀪Xo#!K$0ȻÐ:+Kib>xվx7lZM`W 4RG*28^.t,"w} y(S,y^qƄwXux"% s ݀7'ȞiySRp~ҴHif>2kH4m}ΚF?(;UجG$y_̑i`ڒ.=sԜDѤ4dwP#,x8'u_ K렛GWw1qA^Ŵ[%)ޥ`0zp[QUqVV j\sWGc?M]Hݝf8H;<#k-~no,?dk hZQSk[o U{^v" es9=QFmO\}Nw$ n=*дO'>A2>.z ׽zMtۡܡ0xS.Ed..NOLcҸoH1ídv wszUx3q*O=1THU,Fޗ4G0>x-S 8i#1I\r3ҐPeOZÜ 9>s~4^hǽ.:PF8=q@ iz4hw:RS^ԔP0ZMj=7T$UP|m|3qLb695 9֤.;- tck%U+|Gԉ/wzԡ@Ln (}f%LY 1n0G!r{@NCuV 8r,}j.3hPn7,1WĊ `sJ~\? ǝ&W?&)O/tqRP{N`#TEG_Jaҹ8=ʿ2_0dSnZB;~TLI~4,mŸJnZQ-s"qWFj'pfe];5D鰆HZownԘl,6?;TO`b(5#.}[oaWޜUsLmۈ#Q5ÇD*;449;U@ۓV݂F81&      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHKMNOPQRSUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~c|,aT󃺢lg"1&cd7s؊!#3룲x[˖ dNcW<8mPS uZ^xK$$T1+uP<*M]?qp4[Y³mS#sSs=K6زvoTbMÒ;?7u(VܪWn9poZw+/?wu<9.0F-&\Y~](ݡ{3Kyxgi?xzPԥyU6A3ʪ`v%Xm*7]=B0 qHz6)ZGځ|OROؿ8D*;&#y q\bbtwnoM=:c|qC_j$A?1~۹,I9@X4N)Ho 9iyNzLu;ҋh\dSG#ދR`)J@ iF9L.8NeEalˎ;Զwn O42C6fiXKl$ǜ ; B<}.Cb6UjNNGKع (954q* ?75> 2+F;kDl\1ew?JeBJX #eb{51 23#+dm-tcW,ͷ@!;TziCbG9VZPQ#;W޺ '8iN\bkaLi4sN᝔<ךVR?:z:sZ4?tקzc4ߌҎϽ:=A v]}JTyL3t$n?x#gH]JrYO͏ϑR|zsC8`rjE8UH,)h ,>\|:4. jAv߁4I_jOJv(Tls96̪\mM[czS|܎)12i`A+֫ܭV@n:mEG}+N 9uGE06Z|iy>Gެ/t3X1ZwtyU- čڣ,i+R)%DIYQ(hKmo׵hr4)*a!$XG.Bq5YwUJ4&|a !)++r MIԒV6\+SC.?ަߟ_8H+LlUIV1\pzPPd}Xӷ ZšV,?0smqkn|vs(+.PYJ~^LlB =@m[0/4 n*Q7YB H:xv@;S[n9)`Wr5[ĴT(% 14Qڂs3(188ғtisI1@qGOzSi6;GSbr9siʗ}hN](ϵ3/擓ޔ4Ꮄ}q@`[ļ;Rzvci@깦LaW-1M;U:ЃCԤL"*})ʧ#<4AvI]; 0)8BscY2C U}[P4f"]Vl07gnS"N?b9BkRG:/^B"Эyq^o!.9ݎ +xEWmMG!!j>*C*M&R S}dQ ~Uo~3@8oHq@me6INDéLڣHyLQIpC[gB܎L 60㊇n*F*S%߶uۭJPv*^&p* Oʃמ94P ;vzvG?]QSgN\*:ᏘL 7˻4q@8>Jw/椔C cmW*13})7y<`$p7Wonix~2ۏU^Qvwm|z >X}`,;܇ 򞽩|xXgk'qOF򻂶pr3U^YoUxTK#G϶Rgw&K Ѐa !/LbVAYB) 8BKY,נpMzl[kznݹs򮃶i1sKx'~ʜusGLM \oNۺ`W*s%2fT@||QOq*ܤw X֘AVy23۱H=hď8ف5`S|}6Dy\Srv?P8$Ji<*cB• >Zarz; E2ML|SFv+aSH%v؆+Tl51ƻ" +Qץ;dW49zQۿ“ށyCI \h ƐVyqJ1^)ܳ3~4 aiztҕE! 4oRe4 ^;s\R,.F=Bes@HϽ{a )^~(W_pޣ1`Հ?r84[HjFh?g"A@Xށtkzo45(^iVLbQn-JBZTmD|Ԅ08Hґp}>$6PJJUw|CڀC˨0l1ң2J96vqF.q+&%Bm*Zg@ 65QT{m2~ZCP1bqÒyڂ֙Hڍm'v깠@G\cйF;gd~_=E1zyz>v;y4ض~iiN-10zJP ZI'wBjy7BgYW+פК/ ?y`)47SM=)i9 o(IS-2;e뛩!@J XqEqZDloϡ1hYV2 zSx{P4G"73Q5 #XcNڢ:l9bG{ў:Uf]~ABwX?*|3 F9#QJ8]OGUr8KaZÜ0GZBb8=) {P br8RzqJ9}zҝǐx֓6f rh Sf cš -o$\<Μې Yd) ?i/6 eO,~mEŜm'\cSG2W'EN3&Z1~c͙=i>oO&s܅hJUTr-4]SX<3Ƽz0a)&(,m8iYX \2?XXWI{v|Rzթ>#5HblTkl9͞*\T/?v9ֺF#{c5p# )ꬽ:143[˲x6#ޢ2RN-b?.*"KV) ӆz 1ҘUEQU/L|#M Q-HoUH0xwˊI9|z`l+mSI)zP,M0'b6MS#9 )*U+ީ$B<5'$ Vf$g=D R)?縧U* R',i&?ShhEoaM>͸uBipsg86;7l`to*+ KAh*HN8 SJd+e' X/Rwcۓqޤ\ "$0 zzw$~"Dwޔ@lm?{wWnyS֭6$NjFwݏ8㪔]5c |uʫ8u(0 nݼv|[[ܻJi'iq(c ~q$kt[E5+ūJs ҵUϢi5m4M#_]șm~5 5E@Fx\Uλ9f`[ֽrֵl][as=;~5 R]/tgD3Hn̛;'&[Xj>vKkš<f0A/~FNwVĤF+' Q]NIޞ.MGXX|=̓{3_i+uo^O#u A0Es4)MSaIozCOs{l>x./ksx`/i ];wi 9 =hЗ72 xn"U^YOckiww~նon#Fepyu,> Լ-i4FR<{# OwVKXSnb:^Eua?Ȓ?+O*J`ov]|9mzVznpLf[P6g?=rG{# ry_#YO nT=k]GO 9R>jC;=Yrǩ2ݤܸ 7_jh2ucBPr1F:@ҟ1/Acnӟvʧڐo~ _Յa>mޢU=*Mlm⣐O}+c|-Aᦘ+^om;en72ןxVp-ҽvdvhqwֈ(P h~5rگmR-6x-e2).I͜oִCG<4rt,ï{r:"&(`3k"z]m4 {wHU^rޙǭr~%׭ݵ;Ow:~ka ONZ.OR+k: xB =.n/y]П~WĚ]y 鷦kdI)v˕k F/%_|gyFK; ѤUATqלfK"{ oųUh#0vWQx~b& n+3"Ul6=8jB$b0k%tBY$ʴ`}:[imHd NZ5FPCk# Z[IOrd!e]ȯm&ÔOVl QcEaŷQ` GJvFi9Ġn=M w4+=h!bzOAEę\˓E& l/60ޓJatPŀ=isdf ԛjO0#N_ҝ6sVe9`qM&i(2ڿ.b ]SE nJzE)oWC0H  *$R`1(r,o4+r*ƥ-%Q ǵFɮo` Wc];'O'iT F9*f,1\}ſסN.<پgs|+lcĺYu=4liI+LUR-儷+y pO<+.T=k1a*G޹b 9,판As8jKwBB|1^#?p9>zJDV}{Zb8-=F}z=OS{i3:'r^#H@8PUF̌/lđ@6AIkj:zV\'[oc֋NTamlnkbo Tc=1Gj7f5,gX<{Yq֧s{ۗ_v+7ջԴJ{ė_n, l5-5#p.z;~Əs5{ۆ6Ko.zk+ۘ-Td*cyPdX,tӵ[{ iaRUl0=U?V6 ʀ40n=8X> ^ĺY7l֖B*I*Z[mmEl+qGz9JY[ R1R!{yȢ⸀TU-2N_jEW)\N@AI-N W׏J\Ӛ4^g+j͵@ݍ T;9GTdnzRlUiJ1U/ztO6zwHmĠ!!&E'0Q#G9WiRx#ҽڔמ-DWq?#\Xڵ)ua ?x±%^2޼}Itۚ%дm$`yu1i@:UԴVĚec;ɯ9όIJ!^(k' k[=D۰OսG~'eQŨGኻpDypc?6\izMe[`?iNk2A?~AQͬ3 vѽRۉF:&^4?GE5}h"⦼Gx|{#oz҅ICQ;}G!W_ԌJjmH1o?Tޱ+L˜s#ŸdO_!G#'Mrz]cPn$ٔ烚o71Jnje$r!s>vx`UGr'X}Z$d|c ^Ҿs/Ur̊FMnIu xJb0#_+V+'?[zwm;0=ՉK' *-SD˕_om۽?UM&!gc-[mŧ&Ku`yr}Hb1)GI(NZ=_Iml%LqI弃Ukeu1$`u@GcN#k![rc/֊zJ33)Xk)F^ f{ E]Q I.-Hvw[&UˁQLvx׷k]ZXykucohįy@UkuYs.;U?/'yF)1͏zpEjxH߽bU^j`|4Bcli?-6ƴ\#:x3 jMqͫ. ]!m u(Bp\x̓}vAgqL UUV 1.IjFTo1Ѩ`vmksjtwq$6H9Q+[ 5 %#v _j&˧+J]COL W-]dnϷym2Zn؋Ċ7`CV<W_l眖C$dT!V:JyT^lJی!Rxȩ\3A@ 3f?E/!`~nMr qhX6mo.0 FY͎zRǽ|O Xd,kuJ UyvmWc$wnxmg}A$llD+Cqtton K,ZGT 2D ki&]Iv6N>Jmkk+@9 |[r":ݔ6WCkNj%38y9C留f(m*: WW~]X捺eXv TSzFJtmU{ JIl jkwY{ ϧk8T~BMZ Ț='q_LǥgbZh²t|IJդg}:у 8"P@MylSR%H{>LKIh V 1_Yd6<.3GJÐLٞ eyʻHQBI>u\,elSSHqz4R] \5_ Ovc8ɔև.6O>ΗBz<fiq-bpT&Vor lITYJ~<ʇUYn}](28dnȥr O.3WMq[wx/n7X76vLG,^5R]muCw aVWW57zk2n Soƺ+[*1ϗ(n۰d,9zլDv2~[9gfMi!̊=Wz>eb`Wt*FjɦqJ2N(9=j @<E.((((((4QE/QE-z_k-ˮc~c^i^!?zi@kIjcvM]7j\~q/cezխGEm}z}3K8VH^$7QZ;d#gi8`> i@!8nz8Qn 3[aX/l|N<@ [MIK[e8\d1q؀GqY $o4rE4P fBq'F#t(0Y?v0H KBO̦R11HnQm(ؤ3@zTMkΓ1H(rBIh^TJΣj{R$pmzqSR%fst.܅S8ܑAq"e0JTV Olmvnj= ݠ Oݦ7nT/LN&h#o9ٟ(Q (m*hVuL.aܱpJ˂x'ɖ5^G\\;&e_#Y E7qP+5hm'Rô|,TR]5/ɽTՌp҅e۵oFZ`woݩw|S*2Um wsҥُ1 iVq0$R0\Ƌ-]v&&T8>6y.vyl|o 嵶ʤa=KfK ךm?z|9RO rR@VԮ#;lf<|м3DyDX++cMiF5 QJ)J΀wzڹ۟Fm 2<8Jvt:+'uk[[bO,Hs`i-o h.Q>Wi?\ZB>9H-.G~h=ON[*QT_i.xОǐ* p)%̈́ V.4yљJ1+Zw7veR=FܞYV+fF7-MقK7Wi$Y\:El߻C-9,hʴOq\oZK_{+ecݧ_iڭ?Nwk>a)A4&x?uks5ͫEzx";]=/H]JN_LݰڪFbVD=D~uwj֑qΪW\"Լ Tۺ?0AG^g.tL̊++jJrezօ (iF֙E;֛EQE4Q@Q@ J((qeؼ h3FD2V} !- =jKvsbjѵ3n^jrgU @}sZR<%{jZխ ZX-)27Q c%nA."R-,DZ#ְ $` qƱf rޔQ@}e0ubEKӮ$KxK*4_>0Y-.spw>m\I\¨VGݢYa]ml_+{Sۂ$jOŸ/Ky,i򏗹V6Oj3cTԴCE^\EH7 O|iܿٺr|$Yrozu5yodvӳſ'd-^I 8#oB_JHRCԒ:2{?TJ΍cR2!bզFȁ;JX1V<Uz1fv|ԡ#iwX?6R>liJ)~6S| ?v~O@w|۹3 @?qUHzRĕaݥDm{Tn2?.ieh 6?w3KJ >AW6yf;onܣ&He_WqmuA_*ՋhDUwiUm+m=p¤2UwU-m$Fċ'=k? W\9=s uLQ@GiBm]WPʅ.zznS$_0N$+qԊjhڹzSKkdh7HmbY[Ou0޼vWg;RKFO k翾U_FlA!{?a?6.T֭חrKh<0>Tn=oVK{kwh?(;!R:{ӛšsKGV3d Iiy1y2cwS+߫5F3WN65CP\V7naZ6㬱gR0k@V4bhеHMǬ.*{[y ά%or{"Ud,PG-[[}.}ʐvg/֖z6ŢYʥ&KdkP[I(c &J˲a+(_Qx($kx*fܟNKMu%uno_ka{fcwm J)5yf~Y#3ZLfn \l"9.bV6B@牮# 6)bAzeӤ]\\5^[麞k}6=ҵIҗX%0S$% t?)VVj:`Xٿ a~ XlzF"f&-cN񦉩]F4˜s[=>o5L$5?0d iG-1$d[sFZduo-}I$VlOws=7ֳ-5L->ŪU pgrs&,7O 隼om ԞXE-,¼ uM!ZMcX*y_G}ڽaҪ0x.Dmqn^&>c5%X&at*UL7^)}cwg}l\F~dr+X2)Oue1Q@bSҀ(((( zzZeO+=A|=~DM>g@}Q$ܺ_ 8?L }ݫK;ZFjxmwVHY!f6 u5xGB

Y!eɤ/OFC꭬9?(fZG:lS 򰶨,m<Hۜ &7:db˹Z)eX`?DU-[(P i\sryO9V] K8rDȋnji o6}UsPL"U:M!3=_?XPX p=Sb$&vA$X=b#<_Kmmd2OJcj)*<J}Y- ʴ:v> Brii(t* "ähp3cjqoFr~aEԂ |{hRr>?]܏zxg]ǦCq^꽧=gg>W-߯VQVn1LZm9V[yW_<,?9_Uo?Nsj~G<@-qZ>,## Z:Rp$Bӗ_)~3NB>-Rd[xgL}qoo}V7}.Z-#W~{gkng3cR}?dt{*ٿ*v\V^Tk)Qjr>SO5oo}Sp8gt'^7v֗=3G=3WMH P-99p޶o~O=gï_|3휃|M:xuvoY(>-xE]@t+7J3#tw[Yޱn+|>ۉa̴Ҥ@,fWUfRKAkxC% {jm < C+jWQA%0*$?>_ 䮺s8ÖIk/{K/OT=۝֖۵ϑhj6|K `q X,^_xPͽ vMJj^Z>{ix^R1 }|oj0]h)'H2 s3Ob=kBj(>|Xţ MgAgĿi#|/=MZ}Ρq;ViS__|9jV^ᯆ¾!P[b27ᐶ#!Zx[1ro /ݧʓOGէmM;,S*t!*2$m-/.m&ݓM;ꤚ _~ f ':Cgþ%hnnu 7ggx-R6j%Zic-x=IYh^<<y x_n qGg4O2J巕Bwt"G_Eq??-~)=J&ZDʂ9DۦUdڑ2<~}?Gw/"^7 ҵGk9a{7n#Kƶ~jX7X&)ʭi];mɿپ#Nm[lE7{~M.,fQA&T#m ۔.w 6!_-~zޱ7U[V:|;s]gV·!.XCiydhoǓw?‚2$Gӎ霓p8|=x'ljRN+;wkWn3U>nG ++h+۽qm{jaۧoo?{z{~_!OyZ~{gh9O?Lo#Q{j9>}_&<~y[?g>GϿКM;m-Og1͹fB}gs4 d@ y@fZ+o.և {zUxY"aj~(ʮWDtLoe#HU>I~'eЎe27ەm/V3 hBzNX1X}x߱o Y_5gmN9# qeZE+ѰQ%X;9'>5Aſ QuO7H[n^4hE,870Sм%[՞vP|{HSmY.fB ,Dh$JR6>]ڲsjWbbYF'NSkRrR+G_5u}@C6!0*TʰkF!,ڊ|^T6B*Tc8a늆Ş3ZjM);^BgF@OQ>7sߊ5ß 7WG05տ [$F[{9op^)]Mwkr(j x+)sTxTMv~$e5^߳ r<1:?Yՠ46D|0iVւhY$Mr^E#9V:>,.ȭf_$X# 5^4% 0;Wȿ o؋rwo[FΞ)bܡ)C)R M5QRújvfVN kY1]x{8P@\rW +mu#qÒ>kR3Ƿ%]7UC Ko-ݟuiRu60InACb.|׺cXG'qKǹWkֻ\G ki-ԫSMyicm5Q0X=YE,V_)NJQ`ۛvTk6v\o&Qo*Jbh{6Sh&2$Wi`>|Y$1;G@)\g$U~l@gI%W|"rwF9,k?ԟ _C[a/ׅ|]ie}|k{Oxpf3qCou(Xf+#dž&M)5TaEV^ᷲPVj_Pd>fNVҺIStʣ̕w}SOK$dL.硬O+0n )g{?ƫ}0?.$`X֪FtKꝪ[ϗӳe6ljXp%p8ׁbJ2]R P0FsqY6햬dM&A !$()J.&}a 8Xc*I#'-{+Yw^}^NbͧkvVZ.,583PH)fe9'nGp{}d) gwFa'u5'SUO^lŨ_eƲ04:Zo&$m*kJHOŸ c~'6icAeRmS .o7A)AETqZ'{i&nYf:3v\yI%7IdӎDQ<&[~v1,~P2g. 9GPѣj A/C9GTeH!~\*=_CZskeqM;]դW1iRy/DHⵕWj<6ןߟ{<׷3|=(;eJދȳAhBZcsN.taIFWm(NZ[R/<}oTf\[OlRW?L1Ѭ BlɇUʴmrYٯN`hR "|H,ԏ_ o٬&/|u9kGIa2-ķGp$|mO-</s௅vK.w0#:IFWeXa*Ƭh|%k5G>xS MJI5n<=|D9c1T8F? Nz^hm(8_jCquc.'GԤ2Ԇ]~S#!j^. Pd|-l*>B\>ղ?οr7bп_φG3Wy,"@m@~tHs|131Q(.2)B nLE5hheuk+uKgPt)7)IJ.-]mhV(ߕ}ۯh.Η(`u)!WchN bH`("oMBڋҥӯ?)V |f'(?_No 2/[K|G&ʲmoo &VFY'mo>:sW=o ]P"1-e9;iG_;]Zsԫ*qْd|6YmSVeDڷM꫸¤8Pp o:bI|1~5ƥv,V'~xniVo/#wi?"3Z0hH(S3l;?G7 [[IyrB4o'OpŨxRC0,Fu*jR8bk^;jѽ//vN\B {Y=n5~[>d֤ f#c.Lp74y#8 0-.PHh61.L@ce|qo>iM#MEӯ&K VOM"Z]~KH/')|4m,0>L~ |;1I4򆍠4#۝r𓍯FTI_GSI4'H! rN3HM"I"Cioa"Z()ict2pYPrf]ZIgm.hT\O(~vm F:[G*<ڻͽ Xۚjt̢VmmTir|ٵ~&u?xgWmф,^$%FA?`DRe;P4OS+˝G!k>ԭUdq訐O5e< +V_5 V/?Jxpe㯅jZzdžut+FZ q{ ˬF:Y*@o$R.ߩpEch>+ocSe-IkV=[5vVcI6нH_/WU*MoH+Ii|1euYūG][K0WK ƷKwf Z)HA/'kW㏇pZ?/>(3GixoR[['V3jW8"m]ZZAaq ab,ۃW3rUڕӋ\Ua ƯJNKYm>/Vv&[HY2[`Vf;W-$:< 3TUwDXn^H{k#T?gX%a,1[$ ?o*4Zf=|]zS,F׫wv,XDΏأu_֋Uxb;x[S$3NOveAsݴ < ^$e<) ]EJ;k4ܜ֫nQG3%KYQZ7eѧ{;Eh\g:?\)G 9y34'?~6f|;K?3#=}#V}_&A;zJv?!G,"޿ך͑Uh8?=Ss)O)9[cO ]>oQ?? S %oocj2,^`R7ldNA?trElEcy<PN m 9p䞕{OkA5K t+!\vBEʒM9c+2 2),N"1֑om4niK-.鮭[N=t?7jS]gRJA@5O n忺KiV[VKXmH;{F47;Woٳ >4>/ό| >%m6&,5oX>d6zuz{ݬ?ǏBuV:>|,&xnKmAntɵ=gA{{](i TI+~̟UCw7|^OZź]vzË~ d7"_i׏ydkiwZ*q,zӞQsFwe'&U\JZ;1pPgMFtS/M'k5wI|#WgoIY>xil|M?úMo]RAk6vw1$:# [8ZvW&c txRm6yBIgOǿgO M?gbHy?]9~ϩ,2!Fn--mFi_ؚ毩iPM}4YS +X&խhSٴ`p~҂ *oa}_783d) *RڋqOf|'IbhOm-~tV~ kz4xkIQi70.>x;;AaEa6d lE̯gq+,[FteLu۝ynӼQ/mgA1ꐆ0iҕu _WI?(|ok_쮴I-m_fn&ShmHֶA#?П'% :~0YVxZ_Gc6q3y Zv  !(Sa2o9#"yԤGYNOe(ɸ5{n+软ι*$N7K/7^ JKo [N;lj0\׌5":nZbBɜLqw$#31On001V~=֯|Cý366uqjG{+ +vt~Kc$ |șьnFxd䉱9xe 0%԰.1IFsM'h͵v*cs+Þ-)BWqJ K+7k4ջ7jr>SO5-NAG@ƭ}k?彟9kch9f?Ͽs5s4}Mcsu1[g>GϿ֞v_5s^_Ior9# R={-G_nMં9>ZG.GEaA8'U$ݖ_yXwZO[mW#w%;+ {(9>.:yld -Ď Xf;Fo?C%HG^j:Ok sD&o޶z^Jܼ1s:z?%▕|HG)u?INKRDžrW ]Y}lw0t~~+Լa|Uռa|?N> >O_\=~!H4jZ9d oqq˳W|~frPiԵԛq~ko}i9E\3xEPV1IǗ2KDӫysKދk$M>5xM[/N|=o-ٔȤp 2*1mg;3ͧqs+gklvA=}[ƨm/L6ea"R#P+ ľbsjk & o`i^ $T_ֿ;w}6|=7keҟtw1`<>uTe ~b,U>?__ >xWu`k&ΞZxo@Bּ,Z5Im쬐.\1&{y"J??x6"*i5Ƨdb{K 凉΁lmn/ AnQ_g+o% ?A~Yu+5[6>:/n"y.(mSMk8cg8NJ`jiRh$yJMkwow*ù0z_XzFNa+v߻t/ +A1?>bӴV VzuƠL:d\O2# ua jc-w:cy~myZMBQ{p4#K{?Cd#GY$ Ŀ.X $ .X2@nqeХXGT )@_ >rFG.Ud䊳u7&)#ȃ;1/\*R|m3.W Vdׅ- 'CŇ|ss # \q-2NIWRRk/a%&qfo}g45ˊTܥe}=lkgW3Ip>='j{+j7 cͤ\^ƛ"v8),r)d7̬ ZӤ|ڛ‰w.Sm Ii& _8u~VVw5ƂvSk'/4;GJ\ (Oҥ2=2/`+,>ti,\)ZUw'd4<}7Vo7Jm{W#Kn+id0rK)*[&Pc&fbXyZ9`뛕J-f{'}oWLb*N)EF^F׺򶟳D?ثۃljfٛLqxΗ|vޮkkv;j-z`zk?ٓ ~/k~l>xB5]X^KC_"mKDZӠZ/*y- =C /#xJ ߷|D>o6gxN~ _B5ೋF2};N(Q\/xE,=3zzam2(H\HDl%LHL'$20ӫ́XhNt&eQ(ei4Y6כT,Lg,.!Ν 1:jyU&4}_c>L1MNJ9iw*^<R%r~߳m{r|+K[i-/-#Fcos'^_-gۯWTN\rKP)St5-xTPa:2̿uAqMo/kC߈6F ,H!N౯p&<ʞnJ1d׵{h/iSm5G K{Etӛj?[8(u3B[a)$feZYm9b'l,R)}%\[~bO"twuo{+TcQ1X鿓iox+@TƒU|ێBa`sW'5k{fo!ڻ 9c(%A9٬4h[N rڻ;Zû/[Pt4ni-6Va,೟\[[?Px&-(W{Kekx( S=Ѝq &^Tl?ۯwo4p ~$l$幒e5vM60"3|L MցtPEQ%|(ѧ-ATb-_Y'aT񫍦Q|><>BEfNrf /vs 9 բ axo县 Aͩ+M3#\"].8m:<̽Ŀ cTj6t,I>V\xݮO6iNB!xXמ,j4_:魬|?ߤVKtn-h>ȷWh2$_+N֟Cj8χ>A{RgGQշMF!?!-̟xF7V/ꫥyF@e|"aKf12<7"zUޭmUnAP$]Uc8#jCUh)AUSoE)J2rNxLm;KЩ *FT5jQ|u>-x׎]6OOxt=z mRXLћE6 =/8|G4'4 kj#q8) E. \eEt@-=Fo| j |Kgo?5b%_ u["Q\g`nx}:~v~V=Z$[_GsZʠ3T.\Mo]q^.xʼ}^J,2TtV7մvz7uh^7үk~@aMlpYH1!%w(`w,Kg- ݵo n6fY:ȭm-7Ÿ,ue_x=F+ŗxW I>/+}qi {-B'STo.+٥)m2oknm[2q 55F9NSrrPN^Oݔei5Ե>weNT_lZi(;^jn)>sߴ>x'5~ EemcMKgvȽmY]jhOeXF?Tlm'ԝ-ӻm(~)5_|WWĉG|>g.<7Qk᯴Ζ}+s-^I?egO<4? xķ߳ $ x$H/ K{KbF96W.uo/įj"񞲖xaYm7j]\N374f}Ư|+|U#Ojm .#]:thoh햺}>N>b1ξ+8|:s:΢nyRzGDl0py_qpp:mJ8ti#?j_zzOƺoai,/ž(;}:.63Yx²A6tt7 :&cೊ:%,kX& ϕ1:eX gt`2#>py5g[ K'5%wD="K֗-ySpr9AB0z~~;#=islqWjmAj]jAo9?OW>4g>MWK{uy߇H8@~]3VR 80sӑAG}Oƃlpqǯ#ݵk}uZZϗ?k_׃u G:O>u|F} |Sm{k%%yg..X?i_ړ {[VZ|Bkxf]MBw+ ;`x/gku O f"| þ%lj|sjZ=KyY@baȝ5*oSէx'Þ;o7; \S<;//-67YeԬ'V)R CGgU8sp8~=-=K'):Zub)RqS?F2Y&aC34J[Kޠ{GޒRqO97v<;⻍3nu/xÚQikm%4|_–>(Qg]V6ttU i ~%-Eu]GƱ[+gzl 7ϾXbhK{)2~~߿>#6uo;ㅝuX.Kkkѭ)c55ehrn:AڧďuռG_ ~"i677 ΅aY4;0/$TRy#71oɼTd(ۖIRm-䓋W?QcJTTTݯxϯ,>˺?G\\u+^ ῍o@S-^[ŵQ[+[Ag-PX_Y^x_zĽFZgo$ɭ~KB4OIqmɶ# H摍|4iۏCuG:%+ z C _5ehbC%\[?$åֲ{FNȗl>{=g59vծ8NXj^9E7|{wqwrC(_Tc4 ?ޓ7jtWj掯<\GԨ>Y{gy2M+uV[ ,;>(=i' {Sß K|GźHotPY0 4Y?r>OΥi>֕5֏5Y2D$j\ɉSo53Lľja_>-"p/]6Uwi^a XCw5r滺ln5WR8! Z4 -w7+=Z'?t_K :!kݷ/e$a-,=h@p?a28,ebmKߜ8.{/yݽ0?x1+ezqVQU~šIB7SWI.dm8r8l:d^01Zy  ñ;CY36[iT*ɶ#^8?~+^˯]/=ou'k&y|䍹=}>t9c#7j]zyzY[9ϳ#Qt(pzc۰5mkm=m~{01ECGٽ[H;SRIr2H}9>ji4x[vbؖǮN1ӿNkG+B3=DDXU0BGYU}Zv:bH6Fd-s $OU*& _F8PAcE׌|+?GKF;b<@V]x!DR^IXisJ8y)G]fvj2Jd_VxAپuG\қ67erwx¯xo|"Wź߀(!C}Ikj/f"x[kW&όzx{&hZߊO <PV)."F s˖K6տh3WKqž6ugT[OMsu ZۛY岂I 5v~,eO:w|3 WW-u#An4+'Y'H&GhUxxdU%4M[V׽eD߸_>GJJ-Tq1I;5F(\jir|O״9ߨ *!*X< Uc#wXl{[G{Öe-uiS$lb40BwFN_?_!^|0ټ3ލ2/wO7th#CėbͥCZXG#'ӯ|o [~7:eQInv"㲍t.,t,eҋٳ CxR> fº]ݐf񞇩OO{Km` _]ťs'ů (n~#k<+{ejZOEOhgӤHxd*$a?<禫;ݯ.^hY6Ro][h=x59Rp]e2Q\[iE+HxOW@qxf;;΁͸mV9UH =?l`ZsKS-E凙T' m&,kK=և=%[ 2I&0h<"[~9O>mNQ.wrV-Z0XH+]QfַIE.Hi'Ri'$=Ŷ*]Rf/7՘/Cev#u G_ [#,E tG:mtW+9%`dl2VVZ?>L DB|9i&\ $h%RA7=A/ d3:q8!=gU}ֺ𜮾}chJc.j;-ճ[7t;'Կeol*g%HcjpďBi~'uo 5-F Eο6]\;Y.dpn.8^f/ ~%cY>&xRw.Cgh'!)+ |Ly-JK>0Iߌ|?kK>#f϶fDB^됵hF2jT]}8ghEDnxi6jNh8+ԪǙsRܺB:R /9-IC3yn!_(O' %R%!R$E x?<6S *_A h$6m,pNƛH1$Q)d\,ȸԅ# I,Bgq'ei6-[mvQM[Y?HI7n}R8$gO8&3`@F{IqQ\.jAo;bJUUBUmFQє99#$붝w / s}-m}^?u޳chg>[97*' $mCj>ul@btS$;> @#99\ݺy%^3awFp XIw~4Ѩj%;I]wnNJ)=<>oW~M>}d_iϨ#GF-–ePH ´U:z[T}d-(\ᄰd񧏖SF-O;%:L1.06Gu H$_Oo&~ǚ~K_^6ؠҼ76qn tBQaNoRUnE4,Vowm8*(7AZܼw-eJZ'u?Vi~1cx'DrfYqZʝ _sfCֿ > -*Uo-5X/u=GpRGiL<{ws%AlvD dlrH A5.? o/dK~> j$bx"s6ZDCekS[KoV1t0n{ab# ;g9hzI\ROnG-˲(K8V K]KHY&qN"тPI"3Ʊ G$-D}L\ǩ*Ys#b: `@M7/ƣ,E'|=i3@-KI},JoUmy|;yK x~=[NFhxhDݷ :쬝z;5}5}%^48N|S_^ly֡y՟nl*qU$Mhyc FJ'9>r{|~K!'i>5>z g]*s~[ZZyEKhn 1N?f[;i*+m{)܉18F` ;\zim^NۢFʍ[z=2dY͓98Rm==C\^'Tq[=nZu3pc-~Ks6qf-σdTpH<37څmZskp0C4{,`MvDU1Te&k:VvV9Y.?[+ENj5azͥm";HwіMJ2 m`B@ۉמ}΋!%K'[3±dS'Es*ymRw 7FZ>x7|C⨴o%I)BACbB>VFFl>ixt;K]G!P1ar3Ӑk;?:i.j@*J h4p )><1im{tXBqꐳaQATd|!cR`3U,^{B:ODwm[_M-3 m˯5{>!_4M#~ -/.tvp"vP<.mf,t40"oRt+ !_KZD:_-z0C*|$o-[eXr(~ k|IӾxq<5xB8tOW`bI:8fQܑ$WRKc;y-FxKKzjb|}L]NB<_q~ˤx'w.[G×ZT!iUc奉ss^ ϋ j:Q4|I7g'EG :qYmw Iuoio5?<_ )O|;/0a#9U$KU8}~6xc:5k:e(Lj|'' i-uUcsi{`C&L<P˰>5uSRUFn˚.)r9hڍI;J(T'ƚQrMdڊ?~&_xFffh:䥦g(<풡HkE2,IqI]Ѿ { >x{÷ 4T5LJaϫ[;[>g[$-M-ȵ@B?ؓڃ > ||~Jgzye4YͩZjogy_X'Wc|{~j_Fwk_~7A߃i5+˩5Si"H_j0Pj77_ºKSSV >{sy4)'9(%)_sscT*QnMm\W;O exr©_ب.$)muݶx2zLR[5j~yRV8>:c%R|„~B濪xb,%)YuVK JKEVznx\`Ht1$w\z h8xm+VEޜl#He@\0AR|_GĚ?&hV0lJ_Ml2`[l'73+& .] +TZ[n{Y-Ƹ|lGF%'uu?_tڃߋ.o-J~ >K=lnp,'FM+/`|gǀ5>?ψxX,ǚ%؞Q]:;[+ʖI5y?c+7xs#߉_ඡch3p_/<QYᗍ/4ۭB+KInC?#yaq'U,|eɞQhGڮa|n&a/KN!`w)2mAii%ta8<,+Ч*RpRVQ\{el?WxKǭfcri&t<5? \Jl?t!PmߙtouhZ?$Zݾ[k]y7|,\]#A%hKm)Whe͖I=G\Oi1xgW?M_k>6V0Й&c4 dG-yZ,+9|,ukz֑]|@Ijӵmvs,Q53+V5KAJZD,_7OmSTdӛn)'tZ;c<  }SWWkVOuO FO__.1Y ; [X.$i%(<+Ȣt_̟+^  Se}!]Ϫō֥xQ{[[;i%2ZX\45Acjw {^h_(l5 BK`{MnV6Al#m$ Po^<'gZqDŽ'Ŀ[MxbO_jXkE/b5Omw/˳ &ӓ_eE]GD.`G0',ǥ8*5is{s+Ifdo?e_٣K|1K/sl>!|_xuM.I5䰞 ]Gmmgsn][8#f oξ:a|7?1W*l%kh4:vZ,X48.EY`~$ڿIz? >Gp@&dt{7l~r<֟e&{UEYgZEsW,.p%VAk^+4l-<7af*dt[:k4TF7vm{[Ehv1X,իQӓp^o=9rQvM'ZޡKѵoHoD:'/-%oOK;=FK{Ak :lVIY,I&<t|{Nȳ/1@/K1v-w`<9U{[Lm!խ'kB]4~=|6>3h&y3%>|A_:wIQj)ӊE K[n+K{˘6>x+YSvZն70j~#úڏڼ.N/LprIŻqg{~?ws&[~4Ӵt5[Ձ"͂1 Ֆn[IkDfU ~[Zas|+ Em2U]nWtqqrirn};A8IN0O[2dYe6\Y2H!`[XR6R}kZ῰)xP} 5fRv|sG|2|Y _A x_2x\Fh7nޥI.j1E7I4綖{qua]-U_I vbjmewwݶÍ[r}7c?GS[omDEm'f9,Gt<D|=G q5[_qcѮ.myirt; YeZhK(|Y־,xQxG߄~'xgMCͽ6\=tGY=˪sYE=)nqJ;]ݤw bi<{Nkr[]Z[I]>bm=iw_ 4}:AOt]b \7-k5/'qm &D UTYvir 'k{SvN[~3܏m9? G ˽W7wm(WmƿK4hx'T4':+x+MmVoi1u+keyEkm+QEˮ:齟_~G/n~(Iu4C$~0>.VH͖ ZeK/vß?d|_?kOkRHMYgG^_V4k]d:~toأ7_?5=Bt_5/]CO}隑W𵇌- [mXXȺjQxG9Eӣ(4)E5ȹ\7%V>N~'|% YvqXJs/cمyQ}RQmsExFW2߲׃| /_ExS4};A>~ ˨=v]i7f^'Elami<9<,bB _|L2c햷Q'3>`a*p^>U˻]۔gګ.Kꪵ9+>ZnIii]Ok;ػZoԼGwVǬiPꗋeIwڴQGiPN%} O3)x+tMn]::Oxu+2huxj~(u;;kPUݭV!'ڭPJZX_?mCd_VaaiM gjo{_͵%84`~oQ^r1m;O66wӴO$=I+nbq`|X={? FK)]_gr2cOhRmm y3›ρ?Ain@h ؅dɧ4;'EnMHdni5 i{Tk/t|Uӕ7 NGrdž{0pH!n>lHss%; .~+ԇ6ugcii 20A ?l2GuC%Yg?gF 1Uf%FM5 ~׳Mux2"8!Y[o7zqʪJ/E8i8Ƚ?ctrVݾӥN6_Z6+IoRW}/%{C| α?σEL|1U@^dLy$ qgzcOওah>h֗{xg\ZΗV_i}2M R2 h^2-mO&_nvfˆOf8]XO]߂Gh>"|]C?"btkZxP[(1Kr7(I{Vi9h%~OkOS\kQQs*VwM_N۽zN_kQzE;kW6釉gIKH'H'u 戮߸t0#'Ȟ``'WX\Ict9(s_u /m y-gXe.? |P2#iiis"ƫL[%O xFkT_GNm?hf6:~DSx6+{=f':E|+~殥kki=9yeiax] ETDN74^T웋}ӳh .XRp>$<׎EKf, 8*өQvfY2>Se, w6A8̹ܿ7{b2b Vrs}=Ri.UgVyai5k_+{zk=?7E~_?g o0K [UH5>tqJQ (!8[ySqnXMk?(cKK,l<w emb@I"EC+5wUYwj 6g_]oz/ě- E[ygi&LQM\GAwcO⇎5φ{=e0oϑU i*FlLe(Ҵ.bDTҥ~> l;]NX𿇥kd紅&U@\vѡ|n<Ax_?gw~%g]!.lxKN Qº;jƺV0S/< q_[JPZM&NQis)9rwP/,F:RW Y)VmY+ɨI;i}QRxwhjϣ>gSC_ x_Ş)gCT4ٴ4u gRT>2<kgŝO7x?E'ٚ3}ѱ7V^JpIKK/m{8X*>JKGNJ|\iZ0h<&E_S0ƴ%|F_^rhI+ԚM5t>~x_#zO;2xvu6fvm}ȶ;CSg'qq r-X-/WG r%ZT@!bA*kw?]+χ/R#6hqѢYcS[4sD!8ϋxO?t=SO>xZKEV7QKt\b4֫k7-j&Da VhW JTیҧ94IS8Pg0ȸ}JPTuZ.|B5%:7E›Us+^?7c¿A/~ú"ݝY޴0%ŤVVBIN\:]h, kGt3MqAoX@ӤF"ɷ+I#d!Rֵӵ+WA4KxC]j^Iʶv+[1pmh,]MMJXЎ{ijHSHo7Ɯ%jӥR/q22vSi΋utR{)?bŭϝ/# #̳$EzEc~h*C0t Qn͌8{qd4B,9 =+ʗ|i'`֖qvvVXKTߩв5J}3Vq4g88#pMM/8r|k޲k۲_7e1V+e8Dz=-jHשex߅9)[Y<;K/Rr1Rw(D߆%G|:`e=?x9> ϧNsbOzsm]N`ps>'sT|fϫ:)injUE]UggvޏPZ~[ν쯭/ژ4-!z!\u NH~Aon |1($J2 cw v[-KoyYi xcwtqjƉ48qǯg9OSztoJrN{^E1Xڋd6$+Cƭla9 ?#K?C;|1I{.. ֝r>b9w 5?>Zdײ޺u\'oUg}u?;ޭxRhn'zn ԴGIjN庡_-H K2ڟ"5]>_guy$ER+H@I kG|3a 3R[#zku7 iX0#NI13<_ʉzuoW|U,eΗ_J_W_{Pc7E-SZ4|@̂US!(\M,n">g!yzޔLN~"C Hl.!tR6tU=ֵh]KK4+$9(]%.~di;.E~'|U-͞n^9$3Ə L@[K&x"|:g}᷎|1qZNh*8DHJ3buVܰ#lceb 5uU捬:%k[icR(qm! ~Ο 0:WCi{-'ZKA:֟H=vִk)N񾕯鍨 Ȳ:$Xmd _n~xsu>j_;|>5%>j/ eQs\K5X:]ݳ*x~kƤ)FPM(CSRMMZ^_NyFIŮ~˚:VF}+@$apva؜mP?_O:_o|W>4ZX1ǃtFnYu{>E-~_)._?uUύ[A%hKe3>R$崶ip'hKy~|Wa)b,i7)]Z-{[]cw}읾8ul*8tYKFҧʔRmFs#z/k h3EY$0EC5qx /Z$6KU'[/,^/|PU{2^ݡCGw VToXd0KdNOOVɬiDV?xsW i5aXiA$n<'X-uKjA$xv:luc"j6',KrZ2%"E7^$R6({ut IN:'*:,FoN4:rkU-"V5z%?+-:Q<1+ŲtEwLi=kL|M}ݍF;$3xcV~nM K4r MK'v{XcOxL΍x3˨ܷj ˁs-IoMiV(.ekqΛ#H`\Җf 2`;(eqh?TjYYi^vg.j[l5a;tսtOuۿg]okC l< >݃C~km4q̓a_۳hg>}odOi%E56u Ed&q愔BIm(x!5G;_?W#evڞIxWV Ư H*Ѵ%eF?T~%-f=S_3TP4!ĻX-ʾ2[qXd2y-qs4OIO7b1"uSZ'}}5I%<IZ}m$Ou~'o?oXG4j]kؠg{Eq$Ʋ*L:~xgW:}ڋ'.m.Jȯ,4Z$ 8"¹ +gzb5ȯUuGTxZ,w/$xa.DC:B2 )V\&/}w~! z]&,ce*-D`YM fqqp!5="Ò6Q Gv*B?vЋvBBׅƬ^2qI[ͫ=oZM[B:I'i-W~K] $|*iDŽ-[.H//b>񧅘y- vFכ6.7ԾD/pnCEi‚{$d4 obEGvA(VJʭJi;޳RnNbĪnEQk4E}JŚ֟G uDxgVτnb,Y`$[Gi (QVZ^L9?={>Uo2inuyWQ𮣣~ i^=):U~.mtymt-peI~ok|e MWN𯇮äo~A;eT{Y6gZ][ۨ&Kټ6rohgmWOu|σL<?OWơt;">yIwEb͌sk gk|e(#k~w=GR֠7jjfmᘡ!?6LZYjݬ5ԖY4j?𾊞t.kPy<24P4hlAp'^7Fkk5O 8m*tRk.1i(V-}UTpt)|>;'QMK.[ݫ<|PGI4Oh^O XO6{{moÖZo{O:][N=P1U<[sm$xX+Ŀ NoS⿃|!\1-<;& Y,oRk2\971x|y['5ok붚XAO|vYKR͸Դ4Y^ErgD7m4r۷^7^/usSD775[DDqNy2$1BI1_Z,wQ 0ƨ`!_.Z1X(T)OQZ6rzW)4bqiJ.mGmxDMk6HCiPu#{Cs;Y:d/;a_{꟰wCH4bAv|t/t#I4|2)yѧ8{KY<71;&(}gÚ~=i/x#A^AftaI- yo|_7kZ ޱ.- >ܵ(H~auojDG2-ԯS15}t&׻IEK եEzN0QiF=,SwZKKZ񗂾/:Ԛh5}\*^? |▷e?WC9.m7c㍆j3eY_YIj?k`Ge%Pgh )?hCrk/ujz/&Ry"O jֶyu1L6#㧉h/- <3f3A[4SxVt{$;{4=v?z&wWrqrM+%g/+R~,я3zh___;ۭcMҬjhlZM++G5Ԛ~}m h̓rV9!h~~~#7¿iVzxb= v>]!+w n"T9 V-gOsTB|%umFg7,'2[IhڎKg> dͨ!C[/|Xf| _ |o,ռ; Şi;O0ľSI1HJ厓U*i%ۺWZ.>R[J~6博FۻvZnͩ<|S~)Haikx9q[M5=i(Qi]4%]S]ZQri]V@?EB@|\A21/m^lUx^1$_kdb>a @N910v?gIܳ ,ML;Sm-4ݮ{m748I&ݴu了/R"?R!Ԏ̎?U>yog|SxRw ˬO;MOƿ /;XI$2k&#Kfaڮ;hn.b<Ǩ?I"LƢ 82^E a[O,CTIb4-EiWRdmOolZ~V;G>k ȚKeV)]8!'M_NutI>?סG4Uw\j#z,$„վx˻kVǀ*F.~֯C1Xwy _2/MuM, <<#:'($H̪ ,qnpnΛ[(9+2dR1UL> YxBRNu (]9A״{)&z2~˿g^nEֹ$f;>jp 4|/~l=4skh"=GUa!:Nw$ C%bm"SJU@̈SkZ)?VOxKJz7PdgDP"iҩ0gB/>Ws9NLfvl)|k)y0?(xceZ18JɶYwڵFrZin[o+ςno,-I}v,7J^S(vVBv#{W7gi2?xG iмG;@RWC[mK .?ƿ麎c|DCxE.Y)e,s_mX *NE4|Cg^OȽ'(YZ!+-:Elqq%nN. NJlݪBSSz~lq yXm(77+M)&EÏcD.ӟGOįό? x'E& e_ j~ t [LCOO(I47-?j?ג#Ʈ`|~95} }7O+_!iZ[x1_9"[~a 2Ed$F3vԴ>#wQg|Cυo}K'tF\C]kC{*![Y$3AuϜY. #LYBե;\7y7w)ٕ$a'=|}Y&mk~~+i_VCSrnΰxJeV _沩R)AsBN!F2|[N֙e\;%bcN RƵ9T 7ʪӕHZԣ~mCcq/? 1CQ@lIjH.\g~ZR2e*<b &=&d߅҅O5r6JҖ cVD_'pюs[K((\h$d_=x[<.Υ?oK?Jj*pZ'5t6wTjrI4|*DT-NJV|Zgf]֞0M$x΅FH F\6Ftjo='PSC76l5.E8;&E!c#9a"y?e}xƧc`gk& ڿf/߉9MBT #: +QQ"JvnoUp|Ft{Ñmmv8kZkkORK[Aɴ-G#duy gGu='H ;H_@J#4k~5vvH^i;kefFJDq)~O0?q0?8+"Fpr0f2sQ[#8qF^ʖe#xRR(NP\[$ qӒzN|9COKJ1j6WIſ.4UE.Έc!T 87 f%b,[3!H̬!#8/t]SN2\PBK 5iC1j9qV.UD ǣ⋿X Ǟ~žAt(]>#,Dy`iGp_ fYned2cG#XMϙ5mY/zZI1T0xaw](*J2t5[?WA :mўK1{ӃӠ|*Կ~o F0~o~v)1bA85WO?niS lqU 7+ d-wU^Cuuqm^ G^oGQs{)F%΅k:OUkW/O^I(%\O 9ss!3" ݑeEdn/žW2E$.2aZd3kӾ6x{DOK/A1_=ƒ ~ lIn&%܄!Z4aLjuewhꝬ6z+M,q]FZv=/gk%}/كD?5=W\͡]GwV% ; $/kv[hvOUZ4[~7eYn!>叁xxRO'!pLu*˾+y$YFcy~u[PoMj_A}iiR+ynI-I>jI, *H>׮~#kFr/r5Gź:h"ҼGjfHBZfZ2Zwþ<' ˪BxJju[\M>U߿wtE[o4gSٹϊ vKO XfeȖ]Hӵoj|5˽}젵Ԣ[hjH--e=ⴌ:~-j6(YoR4MI{o4d>*"x_=vö7i"YYZ8i JGo#2ff&aaeIҥ,G3,.m^ͫZ7ZXWB#.ϕ5)|mG/x4o[so.nq/7N-[ɒS~ ,rC! j><-x@ Ω貓 [H]io;a< -$J^4𿇵˥.lnMX+, &V)=eSB[W>0Mҵ \Yʲ <2das$GXsV0%V>یS|WVi^N%jkB+>_nğxnï_~ DѴJR-t$zc|!5W{WO3Jֶ~lN~Jn뗖j<׵ܾ잮V^lGK[4_eojL_6|?e|!jQA,BHkU8nf32JV}V [O⇰߉:6"(ukoC*t:[xficXEi$hd,g/sR}5z^$Փou]-pWN4OSi:']cV'~/]wzWZ-a>]3Kd#y%2y0M^ >$_jTլISDm1-Ika[33,'s^!Lj~!<9'.N xM4rEgՄ$ K-H*kW( J6)HY^W]yǚp)a9儓rm̵iɻIg˭k^˵+۶Keq~xF|3= k Lq^_8 z͕MljS:[JbU7%EnC+.[ozoGO}XеX<;(G& TY D+3!ɖh]6vVh{VJ{ӏ]׹xN4+ sg|-{l.TShEm$3FGe`vLHbe/U?Q<ڶj:Dfz&۾F!m5x'R4 ot-#Qchw^$F.mݑ C=J~[mWm?3ψlJմ/qIW+@%y7+%i7{4v՘\>Kgoz}.ҼEJ#DAi,ޟ}}/W콭8s4]+)&t <1KY6ںON[뽴L^u-G 'K|A6Ӽ/j5ıgAgwB-E w<,LhO{vZV]/O/5㽿,z?|AҵH4o?l5 &<#Kux&2Ep r ޫw~ z?1"Kvẘ("x5V{;x#o`,gkw-.D+6ok^5P u}x*R.tY- J.wy-6>r(T{u?/|cEχݥne3xhGFZ,llѳ[Fo,k'V.J+8MlC%ԱZ¨M4D"3xc3:{4Gx][OkkMc*>[ƪ[+ x%7VE&UJ\M'MM.z][tx_źk~"g-t!ϋxY_HtI(g *Y7^'ӵ?|%{鴛PTY>֐ .|C/oؐh* deF ozw+@38\\'^FhipKެݘTg2si'uk"KOxW?a FѼ%[L+)N5t[+2ͣ"'{)m"Jʌ<ͮwEloWEXaA24R0)2 <y]{k(ga;|l¿ ׭;O iW&$EӮ 6Wnu;30AYRt):`R0QTsI]炍8UTFs$ܣnet#fOӖE\P[j` ,aUʠ/%b?ىGklCO17L8Wͧm-nCaQ_<nr҆e[Xpl CV/3 biˑ]  @hE,| e[hb 5uJaAB JIWR5''+F4*B+ʥd(G qNY╡[崞pWi=nK F6F c-f#%ʨ WLmkDp-F}3|n=$tԃo2 _ݱX-u/KQiHq;HO [H/ZI, ,W‹˥}joX'\KTTְ]SR֩}UtWE8Nos-ZLӋ}ӻVhֿ4Uh/ۤJ Sn@}Xx/^?xCtN=şxOd^Ե/xzׄ4 9cgBx^h`HWEGXo/8^V?#C ]_'鿳XiC5Ꚋު-)-m^-wR= ֊EMbT_F[+(d n3_.~$xk_Sa P5|#wxv͞S3r^G 'Th$ QߩZǚ$Èvݶ qE#]beC0bO xM"U2kz]wZxZŞjV%WXwK5|s4=*M2hp'm2!4a+_}WCrYlu/Eq?^H3ma-;L?v??ট΅lY_tb|{-u,K$r[&–7dy.TfNaJZ>yUmMB1øS5/JJceiTԦr=9o)m!*5 xz]֑6 [dO5uIJyS,[kOA\Xze4CV̤RQC숸f?[gW_ |)j71j1=0U |/jSc,$B9 y<-WKWzt|rcpcicWqg|у;r,gp%G/Qj24+JkFZWk~)c#ɧk߅zDZROi~[mw9 i h3o$xl961K*` ɔmxR+bg{jZޗCx?:_D ÓSG.V6I$'*J$frI+Ͻ(peʸ\GR)x_κ:,_ouyeTE8$K:ibk. ѷ*&I})l#>\ sL fSi~*I7'jQ\Ҕf} Go;4+_ξ5ׅW<Ū[ݪHIuv-e [o ZCԿ eŗduxgHf{M7F+ X)pC1")Чj@x@7*U|$3FʌP&Ú>d|-j?V/i֝(XI`2(7rp; !f5%RTG/gyJMsETceUwA\0\UhQ+4wi7$oN)!kEb(Ug8!3S1TW/